Recombinant Human SPRR2E Protein, SUMO&His-tagged
| Cat.No. : | SPRR2E-2936H |
| Product Overview : | Recombinant Human SPRR2E Protein(P22531)(1-72 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-72 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 20 kDa |
| AASequence : | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPSPPCQPKCPPKSK |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| ◆ Recombinant Proteins | ||
| SPRR2E-2937H | Recombinant Human SPRR2E Protein, GST&His-tagged | +Inquiry |
| Sprr2e-5325M | Recombinant Mouse Sprr2e protein, His-SUMO-tagged | +Inquiry |
| SPRR2E-5310H | Recombinant Human SPRR2E Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SPRR2E-60HFL | Recombinant Full Length Human SPRR2E Protein, Flag tagged | +Inquiry |
| SPRR2E-2936H | Recombinant Human SPRR2E Protein, SUMO&His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR2E Products
Required fields are marked with *
My Review for All SPRR2E Products
Required fields are marked with *
Recently Viewed
