Recombinant Human SPSB2 Protein, GST-tagged
| Cat.No. : | SPSB2-5319H |
| Product Overview : | Human GRCC9 partial ORF ( AAH02983, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPSB2 splA/ryanodine receptor domain and SOCS box containing 2 [ Homo sapiens ] |
| Official Symbol | SPSB2 |
| Synonyms | SPSB2; splA/ryanodine receptor domain and SOCS box containing 2; SPRY domain-containing SOCS box protein 2; GRCC9; SSB 2; gene-rich cluster protein C9; SPRY domain-containing SOCS box protein SSB-2; SSB2; MGC2519; FLJ17395; |
| Gene ID | 84727 |
| mRNA Refseq | NM_001146316 |
| Protein Refseq | NP_001139788 |
| MIM | 611658 |
| UniProt ID | Q99619 |
| ◆ Recombinant Proteins | ||
| SPSB2-5319H | Recombinant Human SPSB2 Protein, GST-tagged | +Inquiry |
| SPSB2-7212H | Recombinant Human SplA/ryanodine Receptor Domain And SOCS Box Containing 2, His-tagged | +Inquiry |
| SPSB2-2942H | Recombinant Human SPSB2, His-tagged | +Inquiry |
| SPSB2-5726R | Recombinant Rat SPSB2 Protein | +Inquiry |
| SPSB2-5385R | Recombinant Rat SPSB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPSB2-1486HCL | Recombinant Human SPSB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPSB2 Products
Required fields are marked with *
My Review for All SPSB2 Products
Required fields are marked with *
