Recombinant Human SREBF2 protein, His-tagged
Cat.No. : | SREBF2-3652H |
Product Overview : | Recombinant Human SREBF2 protein(375-479 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 375-479 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ] |
Official Symbol | SREBF2 |
Synonyms | SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2; SREBP-2; class D basic helix-loop-helix protein 2; sterol regulatory element-binding transcription factor 2; |
Gene ID | 6721 |
mRNA Refseq | NM_004599 |
Protein Refseq | NP_004590 |
MIM | 600481 |
UniProt ID | Q12772 |
◆ Recombinant Proteins | ||
SREBF2-7843H | Recombinant Human SREBF2 protein, His-tagged | +Inquiry |
SREBF2-15974M | Recombinant Mouse SREBF2 Protein | +Inquiry |
RFL21952MF | Recombinant Full Length Mouse Sterol Regulatory Element-Binding Protein 2(Srebf2) Protein, His-Tagged | +Inquiry |
RFL22242HF | Recombinant Full Length Human Sterol Regulatory Element-Binding Protein 2(Srebf2) Protein, His-Tagged | +Inquiry |
SREBF2-8710M | Recombinant Mouse SREBF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SREBF2 Products
Required fields are marked with *
My Review for All SREBF2 Products
Required fields are marked with *