Recombinant Human SRSF10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SRSF10-3170H |
Product Overview : | SFRS13A MS Standard C13 and N15-labeled recombinant protein (NP_006616) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 22.2 kDa |
AA Sequence : | MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SRSF10 serine/arginine-rich splicing factor 10 [ Homo sapiens (human) ] |
Official Symbol | SRSF10 |
Synonyms | SRSF10; serine/arginine-rich splicing factor 10; FUS interacting protein (serine/arginine rich) 1, FUS interacting protein (serine arginine rich) 2, FUSIP1, FUSIP2, neural salient SR protein, SFRS13A, splicing factor, arginine/serine rich 13A; NSSR; SFRS13; splicing factor; arginine/serine rich 13; SR splicing factor 10; SRp38; SRrp40; TASR1; TASR2; splicing factor SRp38; TLS-associated SR protein; neural-salient SR protein; 40 kDa SR-repressor protein; TLS-associated protein TASR; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein 1; TLS-associated serine-arginine protein 2; splicing factor, arginine/serine-rich 13; splicing factor, arginine/serine-rich 13A; serine-arginine repressor protein (40 kDa); TLS-associated protein with Ser-Arg repeats; FUS-interacting serine-arginine-rich protein 1; FUS interacting protein (serine-arginine rich) 1; FUS-interacting protein (serine-arginine rich) 2; TASR; FUSIP1; FUSIP2; SFRS13A; FLJ30749; FLJ43846; DKFZp686H0644; |
Gene ID | 10772 |
mRNA Refseq | NM_006625 |
Protein Refseq | NP_006616 |
MIM | 605221 |
UniProt ID | O75494 |
◆ Recombinant Proteins | ||
SRSF10-3170H | Recombinant Human SRSF10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SRSF10-4290R | Recombinant Rhesus Macaque SRSF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
SRSF10-16009M | Recombinant Mouse SRSF10 Protein | +Inquiry |
SRSF10-4556H | Recombinant Human SRSF10 Protein, GST-tagged | +Inquiry |
SRSF10-990H | Recombinant Human SRSF10 Protein (1-183 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF10-1906HCL | Recombinant Human SFRS13A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRSF10 Products
Required fields are marked with *
My Review for All SRSF10 Products
Required fields are marked with *
0
Inquiry Basket