Recombinant Human SRSF10 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SRSF10-3170H
Product Overview : SFRS13A MS Standard C13 and N15-labeled recombinant protein (NP_006616) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants.
Molecular Mass : 22.2 kDa
AA Sequence : MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SRSF10 serine/arginine-rich splicing factor 10 [ Homo sapiens (human) ]
Official Symbol SRSF10
Synonyms SRSF10; serine/arginine-rich splicing factor 10; FUS interacting protein (serine/arginine rich) 1, FUS interacting protein (serine arginine rich) 2, FUSIP1, FUSIP2, neural salient SR protein, SFRS13A, splicing factor, arginine/serine rich 13A; NSSR; SFRS13; splicing factor; arginine/serine rich 13; SR splicing factor 10; SRp38; SRrp40; TASR1; TASR2; splicing factor SRp38; TLS-associated SR protein; neural-salient SR protein; 40 kDa SR-repressor protein; TLS-associated protein TASR; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein 1; TLS-associated serine-arginine protein 2; splicing factor, arginine/serine-rich 13; splicing factor, arginine/serine-rich 13A; serine-arginine repressor protein (40 kDa); TLS-associated protein with Ser-Arg repeats; FUS-interacting serine-arginine-rich protein 1; FUS interacting protein (serine-arginine rich) 1; FUS-interacting protein (serine-arginine rich) 2; TASR; FUSIP1; FUSIP2; SFRS13A; FLJ30749; FLJ43846; DKFZp686H0644;
Gene ID 10772
mRNA Refseq NM_006625
Protein Refseq NP_006616
MIM 605221
UniProt ID O75494

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRSF10 Products

Required fields are marked with *

My Review for All SRSF10 Products

Required fields are marked with *

0
cart-icon
0
compare icon