Recombinant Human STAG2 protein, His-tagged
Cat.No. : | STAG2-2438H |
Product Overview : | Recombinant Human STAG2 protein(1047-1172 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1047-1172 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STAG2 stromal antigen 2 [ Homo sapiens ] |
Official Symbol | STAG2 |
Synonyms | STAG2; stromal antigen 2; cohesin subunit SA-2; SA 2; SCC3B; SCC3 homolog 2; SA2; SA-2; bA517O1.1; FLJ25871; DKFZp686P168; DKFZp781H1753; |
Gene ID | 10735 |
mRNA Refseq | NM_001042749 |
Protein Refseq | NP_001036214 |
MIM | 300826 |
UniProt ID | Q8N3U4 |
◆ Recombinant Proteins | ||
STAG2-2740H | Recombinant Human STAG2 Protein, His-tagged | +Inquiry |
STAG2-8772M | Recombinant Mouse STAG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
STAG2-16090M | Recombinant Mouse STAG2 Protein | +Inquiry |
STAG2-2438H | Recombinant Human STAG2 protein, His-tagged | +Inquiry |
STAG2-2987H | Recombinant Human STAG2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAG2 Products
Required fields are marked with *
My Review for All STAG2 Products
Required fields are marked with *
0
Inquiry Basket