Recombinant Human STAT1 protein, GST-tagged

Cat.No. : STAT1-2996H
Product Overview : Recombinant Human STAT1 protein(2-230 aa), fused with GST tag, was expressed in E.coli.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-230 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name STAT1 signal transducer and activator of transcription 1, 91kDa [ Homo sapiens ]
Official Symbol STAT1
Synonyms STAT1; signal transducer and activator of transcription 1, 91kDa; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1-alpha/beta; ISGF 3; STAT91; transcription factor ISGF 3 components p91/p84; transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription-1; CANDF7; ISGF-3; DKFZp686B04100;
Gene ID 6772
mRNA Refseq NM_007315
Protein Refseq NP_009330
MIM 600555
UniProt ID P42224

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAT1 Products

Required fields are marked with *

My Review for All STAT1 Products

Required fields are marked with *

0
cart-icon