Recombinant Human STAT1 protein, GST-tagged
| Cat.No. : | STAT1-2996H |
| Product Overview : | Recombinant Human STAT1 protein(2-230 aa), fused with GST tag, was expressed in E.coli. |
| Availability | November 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-230 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | STAT1 signal transducer and activator of transcription 1, 91kDa [ Homo sapiens ] |
| Official Symbol | STAT1 |
| Synonyms | STAT1; signal transducer and activator of transcription 1, 91kDa; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1-alpha/beta; ISGF 3; STAT91; transcription factor ISGF 3 components p91/p84; transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription-1; CANDF7; ISGF-3; DKFZp686B04100; |
| Gene ID | 6772 |
| mRNA Refseq | NM_007315 |
| Protein Refseq | NP_009330 |
| MIM | 600555 |
| UniProt ID | P42224 |
| ◆ Recombinant Proteins | ||
| STAT1-7037H | Recombinant Human STAT1 protein(Met1-Val712), His&GST-tagged | +Inquiry |
| STAT1-4332R | Recombinant Rhesus Macaque STAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STAT1-01H | Recombinant Human STAT1 Protein, GST-tagged | +Inquiry |
| STAT1-73H | Recombinant Human STAT1, no tag | +Inquiry |
| STAT1-4597H | Recombinant Human STAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STAT1-555HCL | Recombinant Human STAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAT1 Products
Required fields are marked with *
My Review for All STAT1 Products
Required fields are marked with *
