Recombinant Human STAT1 protein, GST-tagged
Cat.No. : | STAT1-2996H |
Product Overview : | Recombinant Human STAT1 protein(2-230 aa), fused with GST tag, was expressed in E.coli. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STAT1 signal transducer and activator of transcription 1, 91kDa [ Homo sapiens ] |
Official Symbol | STAT1 |
Synonyms | STAT1; signal transducer and activator of transcription 1, 91kDa; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1-alpha/beta; ISGF 3; STAT91; transcription factor ISGF 3 components p91/p84; transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription-1; CANDF7; ISGF-3; DKFZp686B04100; |
Gene ID | 6772 |
mRNA Refseq | NM_007315 |
Protein Refseq | NP_009330 |
MIM | 600555 |
UniProt ID | P42224 |
◆ Recombinant Proteins | ||
STAT1-30902TH | Recombinant Human STAT1 | +Inquiry |
STAT1-8473H | Active Recombinant Human STAT1, His-tagged | +Inquiry |
STAT1-040H | Recombinant Human STAT1 Protein | +Inquiry |
STAT1-2996H | Recombinant Human STAT1 protein, GST-tagged | +Inquiry |
STAT1-4516R | Recombinant Rhesus monkey STAT1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT1-555HCL | Recombinant Human STAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAT1 Products
Required fields are marked with *
My Review for All STAT1 Products
Required fields are marked with *