Recombinant Human STAT3, His-tagged

Cat.No. : STAT3-2176H
Product Overview : Recombinant Human STAT3(Met1-Asn175), transcript variant 3, fused with C-terminal 6His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-175 a.a.
Description : Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
AA Sequence : MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEID QQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQAN HPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Usage : FOR RESEARCH USE ONLY
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ]
Official Symbol STAT3
Synonyms APRF; HIES; ADMIO; signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor
Gene ID 6774
mRNA Refseq NM_213662
Protein Refseq NP_998827
MIM 102582
UniProt ID P40763
Chromosome Location 17q21.31
Pathway AGE/RAGE pathway, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cellular responses to stress, organism-specific biosystem
Function CCR5 chemokine receptor binding; DNA binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STAT3 Products

Required fields are marked with *

My Review for All STAT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon