Recombinant Human STAT5a, His-tagged
Cat.No. : | STAT5A-01H |
Product Overview : | A DNA sequence encoding Human STAT5A ( a.a.129-712 ) was fused with a His tag . |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 129-712 a.a. |
Form : | 20 mM Tris-HCl, 200 mM NaCl, pH7.4 |
Molecular Mass : | ~67kDa |
AA Sequence : | PAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETA LQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSW CEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVR LLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRAD RRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVL WPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVM EVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSI RSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASAD |
Purity : | >92% as determined by SDS-PAGE |
Storage : | Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. |
Gene Name | STAT5A signal transducer and activator of transcription 5A [ Homo sapiens ] |
Official Symbol | STAT5A |
Synonyms | STAT5A; signal transducer and activator of transcription 5A; STAT5; MGF; |
Gene ID | 6776 |
mRNA Refseq | NM_003152 |
Protein Refseq | NP_003143 |
MIM | 601511 |
UniProt ID | P42229 |
Chromosome Location | 17q11.2 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; |
Function | RNA polymerase II core promoter sequence-specific DNA binding; calcium ion binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
STAT5A-4334R | Recombinant Rhesus Macaque STAT5A Protein, His (Fc)-Avi-tagged | +Inquiry |
STAT5A-01H | Recombinant Human STAT5a, His-tagged | +Inquiry |
STAT5A-151H | Recombinant Human STAT5A Protein, DYKDDDDK-tagged | +Inquiry |
STAT5A-352HFL | Recombinant Full Length Human STAT5A Protein, C-Flag-tagged | +Inquiry |
STAT5A-1498H | Recombinant Human STAT5A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT5A-1416HCL | Recombinant Human STAT5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (1)
- Q&As (0)
Customer Reviews
Write a reviewReviews
03/14/2025
Yes, we tested it, and it worked great for our experiments. Thank you for the shipping! We are fine for now, but if we need more we will let you know. - Customer from @hci.utah.edu
Ask a Question for All STAT5A Products
Required fields are marked with *
My Review for All STAT5A Products
Required fields are marked with *