Recombinant Human STK4 protein, GST-tagged

Cat.No. : STK4-30118H
Product Overview : Recombinant Human STK4 (383-451 aa) protein, fused to GST tag, was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Arg383-Leu451
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name STK4 serine/threonine kinase 4 [ Homo sapiens ]
Official Symbol STK4
Synonyms STK4; serine/threonine kinase 4; serine/threonine-protein kinase 4; kinase responsive to stress 2; KRS2; mammalian sterile 20 like 1; MST1; yeast Ste20 like; YSK3; MST-1; STE20-like kinase MST1; mammalian sterile 20-like 1; mammalian STE20-like protein kinase 1; serine/threonine-protein kinase Krs-2; dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)); DKFZp686A2068;
Gene ID 6789
mRNA Refseq NM_006282
Protein Refseq NP_006273
MIM 604965
UniProt ID Q13043

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STK4 Products

Required fields are marked with *

My Review for All STK4 Products

Required fields are marked with *

0
cart-icon
0
compare icon