Recombinant Human STK4 protein, GST-tagged
Cat.No. : | STK4-30118H |
Product Overview : | Recombinant Human STK4 (383-451 aa) protein, fused to GST tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Arg383-Leu451 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STK4 serine/threonine kinase 4 [ Homo sapiens ] |
Official Symbol | STK4 |
Synonyms | STK4; serine/threonine kinase 4; serine/threonine-protein kinase 4; kinase responsive to stress 2; KRS2; mammalian sterile 20 like 1; MST1; yeast Ste20 like; YSK3; MST-1; STE20-like kinase MST1; mammalian sterile 20-like 1; mammalian STE20-like protein kinase 1; serine/threonine-protein kinase Krs-2; dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)); DKFZp686A2068; |
Gene ID | 6789 |
mRNA Refseq | NM_006282 |
Protein Refseq | NP_006273 |
MIM | 604965 |
UniProt ID | Q13043 |
◆ Recombinant Proteins | ||
STK4-2960H | Recombinant Human STK4 Protein, MYC/DDK-tagged | +Inquiry |
Stk4-6194M | Recombinant Mouse Stk4 Protein, Myc/DDK-tagged | +Inquiry |
STK4-30251TH | Recombinant Human STK4 | +Inquiry |
STK4-2127H | Recombinant Human STK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
STK4-4530R | Recombinant Rhesus monkey STK4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STK4-604HCL | Recombinant Human STK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK4 Products
Required fields are marked with *
My Review for All STK4 Products
Required fields are marked with *