Recombinant Human STK4 protein, GST-tagged

• Cat.No.: STK4-30118H
• Product Overview: Recombinant Human STK4 (383-451 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Arg383-Leu451
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: STK4 serine/threonine kinase 4 [ Homo sapiens ]
• Official Symbol: STK4
• Synonyms: STK4; serine/threonine kinase 4; serine/threonine-protein kinase 4; kinase responsive to stress 2; KRS2; mammalian sterile 20 like 1; MST1; yeast Ste20 like; YSK3; MST-1; STE20-like kinase MST1; mammalian sterile 20-like 1; mammalian STE20-like protein kinase 1; serine/threonine-protein kinase Krs-2; dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)); DKFZp686A2068
• Gene ID: 6789
• mRNA Refseq: NM_006282
• Protein Refseq: NP_006273
• MIM: 604965
• UniProt ID: Q13043