Recombinant Human SUMO2 protein, His-tagged

Cat.No. : SUMO2-3732H
Product Overview : Recombinant Human SUMO2 protein(1-95 aa), fused to His tag, was expressed in E. coli.
Availability May 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-95 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUMO2
Synonyms SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; small ubiquitin-like modifier 2; HSMT3; SUMO3; Smt3A; SMT3H2; MGC117191;
Gene ID 6613
mRNA Refseq NM_001005849
Protein Refseq NP_001005849
MIM 603042
UniProt ID P61956

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SUMO2 Products

Required fields are marked with *

My Review for All SUMO2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon