Recombinant Human SUMO2 protein, His-tagged
| Cat.No. : | SUMO2-3732H |
| Product Overview : | Recombinant Human SUMO2 protein(1-95 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 10, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-95 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUMO2 |
| Synonyms | SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; small ubiquitin-like modifier 2; HSMT3; SUMO3; Smt3A; SMT3H2; MGC117191; |
| Gene ID | 6613 |
| mRNA Refseq | NM_001005849 |
| Protein Refseq | NP_001005849 |
| MIM | 603042 |
| UniProt ID | P61956 |
| ◆ Recombinant Proteins | ||
| SUMO2-4377R | Recombinant Rhesus Macaque SUMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUMO2-432H | Recombinant Human SUMO2 Protein, GST-tagged | +Inquiry |
| SUMO2-433H | Recombinant Human SUMO2 Protein | +Inquiry |
| SUMO2-28787TH | Recombinant Human SUMO2 | +Inquiry |
| SUMO2-5499R | Recombinant Rat SUMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUMO2-1722HCL | Recombinant Human SUMO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMO2 Products
Required fields are marked with *
My Review for All SUMO2 Products
Required fields are marked with *
