Recombinant Human SUMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SUMO2-2921H |
Product Overview : | SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005849) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQLEMEDEDTIDVFQQQTGGVYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SUMO2 small ubiquitin like modifier 2 [ Homo sapiens (human) ] |
Official Symbol | SUMO2 |
Synonyms | SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2, SMT3 suppressor of mif two 3 homolog 2 (yeast), SMT3H2; small ubiquitin-related modifier 2; SMT3B; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; small ubiquitin-like modifier 2; HSMT3; SUMO3; Smt3A; SMT3H2; MGC117191; |
Gene ID | 6613 |
mRNA Refseq | NM_001005849 |
Protein Refseq | NP_001005849 |
MIM | 603042 |
UniProt ID | P61956 |
◆ Recombinant Proteins | ||
SUMO2-734C | Recombinant Cynomolgus Monkey SUMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUMO2-1336S | Recombinant Human SUMO2 Protein (M1-Y95), Tag Free | +Inquiry |
SUM02-13H | Recombinant Human SUM02 | +Inquiry |
DiSUMO2-349H | Recombinant Human SUMO2 Protein | +Inquiry |
SUMO2-591H | Active Recombinant Human SUMO2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMO2-1722HCL | Recombinant Human SUMO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUMO2 Products
Required fields are marked with *
My Review for All SUMO2 Products
Required fields are marked with *