Recombinant Human SYCP3 protein, GST-tagged
| Cat.No. : | SYCP3-30174H |
| Product Overview : | Recombinant Human SYCP3 (13-236 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Gly13-Phe236 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | GKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | SYCP3 synaptonemal complex protein 3 [ Homo sapiens ] |
| Official Symbol | SYCP3 |
| Synonyms | SYCP3; synaptonemal complex protein 3; COR1; SCP3; SPGF4; MGC71888; |
| Gene ID | 50511 |
| mRNA Refseq | NM_001177948 |
| Protein Refseq | NP_001171419 |
| MIM | 604759 |
| UniProt ID | Q8IZU3 |
| ◆ Recombinant Proteins | ||
| SYCP3-30174H | Recombinant Human SYCP3 protein, GST-tagged | +Inquiry |
| Sycp3-4856M | Recombinant Mouse Sycp3 protein, Avi-tagged, Biotinylated | +Inquiry |
| Sycp3-4858M | Recombinant Mouse Sycp3 protein | +Inquiry |
| SYCP3-12HFL | Recombinant Full Length Human synaptonemal complex protein 3 Protein, His-tagged | +Inquiry |
| SYCP3-738C | Recombinant Cynomolgus Monkey SYCP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYCP3-1322HCL | Recombinant Human SYCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYCP3 Products
Required fields are marked with *
My Review for All SYCP3 Products
Required fields are marked with *



