Recombinant Human TAF12 protein, His-tagged

• Cat.No.: TAF12-2460H
• Product Overview: Recombinant Human TAF12 protein(1-161 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-161 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [ Homo sapiens ]
• Official Symbol: TAF12
• Synonyms: TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa; TAF2J, TATA box binding protein (TBP) associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID subunit 12; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; transcription initiation factor TFIID 20/15 kDa subunits; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD; TAF2J
• Gene ID: 6883
• mRNA Refseq: NM_001135218
• Protein Refseq: NP_001128690
• MIM: 600773
• UniProt ID: Q16514