Recombinant Human TAF12 protein, His-tagged

Cat.No. : TAF12-2460H
Product Overview : Recombinant Human TAF12 protein(1-161 aa), fused to His tag, was expressed in E. coli.
Availability September 01, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-161 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [ Homo sapiens ]
Official Symbol TAF12
Synonyms TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa; TAF2J, TATA box binding protein (TBP) associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID subunit 12; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; transcription initiation factor TFIID 20/15 kDa subunits; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD; TAF2J;
Gene ID 6883
mRNA Refseq NM_001135218
Protein Refseq NP_001128690
MIM 600773
UniProt ID Q16514

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TAF12 Products

Required fields are marked with *

My Review for All TAF12 Products

Required fields are marked with *

0
cart-icon
0
compare icon