Recombinant Human TAF12 protein, His-tagged
Cat.No. : | TAF12-2460H |
Product Overview : | Recombinant Human TAF12 protein(1-161 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-161 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TAF12 TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa [ Homo sapiens ] |
Official Symbol | TAF12 |
Synonyms | TAF12; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa; TAF2J, TATA box binding protein (TBP) associated factor, RNA polymerase II, J, 20kD; transcription initiation factor TFIID subunit 12; TAFII20; TAFII20/TAFII15; TAFII-20/TAFII-15; transcription initiation factor TFIID 20/15 kDa subunits; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD; TAF2J; |
Gene ID | 6883 |
mRNA Refseq | NM_001135218 |
Protein Refseq | NP_001128690 |
MIM | 600773 |
UniProt ID | Q16514 |
◆ Recombinant Proteins | ||
Taf12-6276M | Recombinant Mouse Taf12 Protein, Myc/DDK-tagged | +Inquiry |
TAF12-3101H | Recombinant Human TAF12, GST-tagged | +Inquiry |
TAF12-6392H | Recombinant Human TAF12 Protein (Met1-Lys161), N-His tagged | +Inquiry |
TAF12-2460H | Recombinant Human TAF12 protein, His-tagged | +Inquiry |
TAF12-9827Z | Recombinant Zebrafish TAF12 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF12-1276HCL | Recombinant Human TAF12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF12 Products
Required fields are marked with *
My Review for All TAF12 Products
Required fields are marked with *