Recombinant Human TAF1C, His-tagged
| Cat.No. : | TAF1C-30935TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 247-742 of Human TAF1C Isoform 2 with N terminal His tag; Predicted MWt 55 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 247-742 a.a. |
| Description : | Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the largest SL1-specific TAF. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 163 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TGISLSPHLPGELAICSRSGAVCLWSPEDGLRQIYRDPET LVFRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPP GCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPT LHLVCTQFSLYLVDERLPLVPMLKWNHGLPSPLLLARL LPPPRPSCVQPLLLGGQGGQLQLLHLAEGASVPRLAGPPQSLPSRIDSLPAFPLLEPKIQWRLQERLKAPTIGLAAVV PPLPSAPTPGLVLFQLSAAGDVFYQQLRPQVDSSLRRD AGPPGDTQPDCHAPTASWTSQDTAGCSQWLKALLKVPL APPVWTAPTFTHRQMLGSTELRREEEEGQRLGVLRKAM ARGQLLLQRDLGSLPAAEPPPAPESGLEDKLSERLGEAWAGRGAAWWERQQGRTSEPGRQTRRPKRRTQLSSSFSLSG HVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDA CAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPP |
| Gene Name | TAF1C TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa [ Homo sapiens ] |
| Official Symbol | TAF1C |
| Synonyms | TAF1C; TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa; TATA box binding protein (TBP) associated factor, RNA polymerase I, C, 110kD; TATA box-binding protein-associated factor RNA polymerase I subunit C; MGC:39976; SL1; TAFI |
| Gene ID | 9013 |
| mRNA Refseq | NM_001243156 |
| Protein Refseq | NP_001230085 |
| MIM | 604905 |
| Uniprot ID | Q15572 |
| Chromosome Location | 16q24 |
| Pathway | RNA Polymerase I Chain Elongation, organism-specific biosystem; RNA Polymerase I Promoter Clearance, organism-specific biosystem; RNA Polymerase I Promoter Escape, organism-specific biosystem; RNA Polymerase I Transcription, organism-specific biosystem; RNA Polymerase I Transcription Initiation, organism-specific biosystem; |
| Function | DNA binding; |
| ◆ Recombinant Proteins | ||
| TAF1C-5915R | Recombinant Rat TAF1C Protein | +Inquiry |
| TAF1C-5574R | Recombinant Rat TAF1C Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAF1C-8966M | Recombinant Mouse TAF1C Protein, His (Fc)-Avi-tagged | +Inquiry |
| TAF1C-16392M | Recombinant Mouse TAF1C Protein | +Inquiry |
| TAF1C-30935TH | Recombinant Human TAF1C, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TAF1C-1733HCL | Recombinant Human TAF1C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TAF1C Products
Required fields are marked with *
My Review for All TAF1C Products
Required fields are marked with *
