Recombinant Human TBX18 Protein (1-607 aa), His-SUMO-tagged
Cat.No. : | TBX18-827H |
Product Overview : | Recombinant Human TBX18 Protein (1-607 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-607 aa |
Description : | Acts as transcriptional repressor involved in developmental processes of a variety of tissues and organs, including the heart and coronary vessels, the ureter and the vertebral column. Required for bryonic development of the sino atrial node (SAN) head area. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 80.8 kDa |
AA Sequence : | MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSSQVSAHMV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TBX18 T-box 18 [ Homo sapiens ] |
Official Symbol | TBX18 |
Synonyms | TBX18; T-box 18; T-box protein 18; |
Gene ID | 9096 |
mRNA Refseq | NM_001080508 |
Protein Refseq | NP_001073977 |
MIM | 604613 |
UniProt ID | O95935 |
◆ Recombinant Proteins | ||
TBX18-827H | Recombinant Human TBX18 Protein (1-607 aa), His-SUMO-tagged | +Inquiry |
TBX18-9472Z | Recombinant Zebrafish TBX18 | +Inquiry |
TBX18-6023C | Recombinant Chicken TBX18 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX18-655HCL | Recombinant Human TBX18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBX18 Products
Required fields are marked with *
My Review for All TBX18 Products
Required fields are marked with *
0
Inquiry Basket