Recombinant Human TDO2 protein, His-tagged
| Cat.No. : | TDO2-3408H |
| Product Overview : | Recombinant Human TDO2 protein(55-406 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 55-406 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens ] |
| Official Symbol | TDO2 |
| Synonyms | TDO2; tryptophan 2,3-dioxygenase; TDO; TPH2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; TO; TRPO; |
| Gene ID | 6999 |
| mRNA Refseq | NM_005651 |
| Protein Refseq | NP_005642 |
| MIM | 191070 |
| UniProt ID | P48775 |
| ◆ Recombinant Proteins | ||
| TDO2-7413HFL | Recombinant Full Length Human TDO2, Flag-tagged | +Inquiry |
| TDO2-3171H | Recombinant Human TDO2 protein, GST-tagged | +Inquiry |
| TDO2-3558H | Recombinant Human TDO2 protein, His-SUMO-tagged | +Inquiry |
| TDO2-3408H | Recombinant Human TDO2 protein, His-tagged | +Inquiry |
| TDO2-16601M | Recombinant Mouse TDO2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDO2 Products
Required fields are marked with *
My Review for All TDO2 Products
Required fields are marked with *
