Recombinant Human TDO2 protein, His-tagged
Cat.No. : | TDO2-3408H |
Product Overview : | Recombinant Human TDO2 protein(55-406 aa), fused to His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 55-406 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens ] |
Official Symbol | TDO2 |
Synonyms | TDO2; tryptophan 2,3-dioxygenase; TDO; TPH2; tryptophanase; tryptophan oxygenase; tryptophan pyrrolase; tryptamin 2,3-dioxygenase; TO; TRPO; |
Gene ID | 6999 |
mRNA Refseq | NM_005651 |
Protein Refseq | NP_005642 |
MIM | 191070 |
UniProt ID | P48775 |
◆ Recombinant Proteins | ||
TDO2-3557H | Recombinant Human TDO2 protein, His-SUMO-tagged | +Inquiry |
TDO2-2503H | Recombinant Human Tryptophan 2,3-Dioxygenase, His-tagged | +Inquiry |
TDO216711H | Recombinant Human TDO2 (1-406) Protein | +Inquiry |
TDO2-3408H | Recombinant Human TDO2 protein, His-tagged | +Inquiry |
TDO2-724H | Recombinant Human TDO2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDO2-1156HCL | Recombinant Human TDO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDO2 Products
Required fields are marked with *
My Review for All TDO2 Products
Required fields are marked with *
0
Inquiry Basket