Recombinant Human TFDP1 protein, GST-tagged
| Cat.No. : | TFDP1-4040H |
| Product Overview : | Recombinant Human TFDP1 protein(101-249 aa), fused with GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 101-249 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | SAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | TFDP1 transcription factor Dp-1 [ Homo sapiens ] |
| Official Symbol | TFDP1 |
| Synonyms | TFDP1; transcription factor Dp-1; Dp 1; DP1; DRTF1; DRTF1-polypeptide 1; E2F dimerization partner 1; E2F-related transcription factor; Dp-1; |
| Gene ID | 7027 |
| mRNA Refseq | NM_007111 |
| Protein Refseq | NP_009042 |
| MIM | 189902 |
| UniProt ID | Q14186 |
| ◆ Recombinant Proteins | ||
| TFDP1-2178H | Recombinant Human TFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TFDP1-4039H | Recombinant Human TFDP1 protein, His-tagged | +Inquiry |
| TFDP1-6416H | Recombinant Human TFDP1 Protein (Gly6-Asp410), N-GST tagged | +Inquiry |
| TFDP1-3198H | Recombinant Human TFDP1, GST-tagged | +Inquiry |
| TFDP1-4040H | Recombinant Human TFDP1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TFDP1-1132HCL | Recombinant Human TFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFDP1 Products
Required fields are marked with *
My Review for All TFDP1 Products
Required fields are marked with *
