Recombinant Human TFDP1 protein, GST-tagged

Cat.No. : TFDP1-4040H
Product Overview : Recombinant Human TFDP1 protein(101-249 aa), fused with GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 101-249 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : SAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name TFDP1 transcription factor Dp-1 [ Homo sapiens ]
Official Symbol TFDP1
Synonyms TFDP1; transcription factor Dp-1; Dp 1; DP1; DRTF1; DRTF1-polypeptide 1; E2F dimerization partner 1; E2F-related transcription factor; Dp-1;
Gene ID 7027
mRNA Refseq NM_007111
Protein Refseq NP_009042
MIM 189902
UniProt ID Q14186

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFDP1 Products

Required fields are marked with *

My Review for All TFDP1 Products

Required fields are marked with *

0
cart-icon