Recombinant Human TGFB1 protein(281-390 aa), N-MBP & C-His-tagged
| Cat.No. : | TGFB1-2510H |
| Product Overview : | Recombinant Human TGFB1 protein(P01137)(281-390 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 281-390 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 55 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Gene Name | TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
| Official Symbol | TGFB1 |
| Synonyms | TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide; LAP; DPD1; TGFB; |
| Gene ID | 7040 |
| mRNA Refseq | NM_000660 |
| Protein Refseq | NP_000651 |
| MIM | 190180 |
| UniProt ID | P01137 |
| ◆ Recombinant Proteins | ||
| TGFB1-17H | Active Recombinant Human TGFB1 Protein, Pre-aliquoted | +Inquiry |
| TGFB1-3754H | Recombinant Human TGFB1 protein | +Inquiry |
| TGFB1-5693R | Recombinant Rat TGFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TGFB1-057H | Active Recombinant Human TGFB1 protein | +Inquiry |
| TGFB1-1250H | Recombinant Human TGFB1 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| TGFB1-051H | Active Recombinant Human TGFB1 Homodimer | +Inquiry |
| TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
| TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
| TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
| TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
