Recombinant Human TGFB1 protein(281-390 aa), N-MBP & C-His-tagged
Cat.No. : | TGFB1-2510H |
Product Overview : | Recombinant Human TGFB1 protein(P01137)(281-390 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 281-390 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 55 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
Gene Name | TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
Official Symbol | TGFB1 |
Synonyms | TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide; LAP; DPD1; TGFB; |
Gene ID | 7040 |
mRNA Refseq | NM_000660 |
Protein Refseq | NP_000651 |
MIM | 190180 |
UniProt ID | P01137 |
◆ Recombinant Proteins | ||
Tgfb1-520MB | Recombinant Mouse Tgfb1 protein, His-tagged, Biotinylated | +Inquiry |
TGFB1-3755H | Recombinant Human TGFB1 Protein(Leu30-Arg278(C33S)), His-Avi-tagged, Biotinylated | +Inquiry |
TGFB1-6431H | Recombinant Human TGFB1 Protein (Leu30-Ser390), N-His tagged | +Inquiry |
TGFB1-6430H | Recombinant Human TGFB1 Protein (Leu30-Ser390), N-His tagged | +Inquiry |
TGFB1-362H | Recombinant Human TGFB1 protein, His-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
0
Inquiry Basket