Recombinant Human TGFB1 protein(281-390 aa), N-MBP & C-His-tagged

Cat.No. : TGFB1-2510H
Product Overview : Recombinant Human TGFB1 protein(P01137)(281-390 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His&MBP
Protein Length : 281-390 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 55 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Gene Name TGFB1 transforming growth factor, beta 1 [ Homo sapiens ]
Official Symbol TGFB1
Synonyms TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide; LAP; DPD1; TGFB;
Gene ID 7040
mRNA Refseq NM_000660
Protein Refseq NP_000651
MIM 190180
UniProt ID P01137

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFB1 Products

Required fields are marked with *

My Review for All TGFB1 Products

Required fields are marked with *

0
cart-icon