Expand
Expand
| Cat.No.: | TGFBR2-159H |
| Product Overview: | The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
| Source: | HEK293 |
| Species: | Human |
| Tag : | Fc |
| Form: | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
| Molecular Mass: | Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60 |
| AA Sequence: | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC SCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin: | <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method |
| Purity: | >95% judged by SDS-PAGE under reducing condition |
| Storage: | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. |
| Gene Name: | TGFBR2 transforming growth factor beta receptor 2 [ Homo sapiens (human) ] |
| Official Symbol: | TGFBR2 |
| Synonyms: | TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFBRII; TGFbeta-RII |
| Gene ID: | 7048 |
| mRNA Refseq: | NM_001024847.2 |
| Protein Refseq: | NP_001020018.1 |
| UniProt ID: | P37173 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All TGFBR2 Products
Download Datasheet