"TGFBR2" Related Products

Expand
Expand

Recombinant Human TGFBR2 Protein, Fc tagged

Cat.No.: TGFBR2-159H
Product Overview: The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: HEK293
Species: Human
Tag : Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Molecular Mass: Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60
AA Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC
SCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks.
Gene Name: TGFBR2 transforming growth factor beta receptor 2 [ Homo sapiens (human) ]
Official Symbol: TGFBR2
Synonyms: TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFBRII; TGFbeta-RII
Gene ID: 7048
mRNA Refseq: NM_001024847.2
Protein Refseq: NP_001020018.1
UniProt ID: P37173

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.