- Chicken(1)
- Cynomolgus Monkey(2)
- Human(12)
- Mouse(2)
- Rat(3)
- Rhesus Macaque(1)
- Zebrafish(1)
Recombinant Human TGFBR2 Protein, Fc tagged
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
| Cat.No. : | TGFBR2-159H |
| Product Overview : | The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
| Source : | HEK293 |
| Species : | Human |
| Tag : | Fc |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
| Molecular Mass : | Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60 |
| AA Sequence : |
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC SCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. |
| Gene Name : | TGFBR2 transforming growth factor beta receptor 2 [ Homo sapiens (human) ] |
| Official Symbol : | TGFBR2 |
| Synonyms : | TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFBRII; TGFbeta-RII |
| Gene ID : | 7048 |
| mRNA Refseq : | NM_001024847.2 |
| Protein Refseq : | NP_001020018.1 |
| UniProt ID : | P37173 |
◆ Recombinant Protein
| TGFBR2-703H | Recombinant Human TGFBR2 Protein, MYC/DDK-tagged | +Inquiry |
| TGFBR2-377H | Recombinant Human TGFBR2 Protein (Met1-Gln166), His-tagged | +Inquiry |
| TGFBR2-8814C | Recombinant Cynomolgus TGFBR2, Fc tagged | +Inquiry |
| TGFBR2-1684H | Recombinant Human Transforming Growth Factor, Beta Receptor II (70/80kDa) | +Inquiry |
| TGFBR2-9644Z | Recombinant Zebrafish TGFBR2 | +Inquiry |
|
|
◆ Lysates
| TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
| TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
| TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
|
|
