Recombinant Human TGFBR2 Protein, Fc tagged

PRODUCTS

Home / Products / Recombinant Human TGFBR2 Protein, Fc tagged

Recombinant Human TGFBR2 Protein, Fc tagged

TGFBR2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TGFBR2-159H
Product Overview : The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : HEK293
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Molecular Mass : Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60
AA Sequence : TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC
SCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS
CSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks.
Gene Name : TGFBR2 transforming growth factor beta receptor 2 [ Homo sapiens (human) ]
Official Symbol : TGFBR2
Synonyms : TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFBRII; TGFbeta-RII
Gene ID : 7048
mRNA Refseq : NM_001024847.2
Protein Refseq : NP_001020018.1
UniProt ID : P37173

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.