Recombinant Human TIMP1 protein, His-tagged
Cat.No. : | TIMP1-7822H |
Product Overview : | Recombinant Human TIMP1 protein(1-146 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-146 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TIMP1 TIMP metallopeptidase inhibitor 1 [ Homo sapiens ] |
Official Symbol | TIMP1 |
Synonyms | TIMP1; TIMP metallopeptidase inhibitor 1; CLGI, TIMP, tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor); metalloproteinase inhibitor 1; EPO; TIMP-1; collagenase inhibitor; erythroid potentiating activity; erythroid-potentiating activity; fibroblast collagenase inhibitor; tissue inhibitor of metalloproteinases 1; EPA; HCI; CLGI; TIMP; FLJ90373; |
mRNA Refseq | NM_003254 |
Protein Refseq | NP_003245 |
MIM | 305370 |
UniProt ID | P01033 |
Gene ID | 7076 |
◆ Recombinant Proteins | ||
TIMP1-5733R | Recombinant Rat TIMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMP1-1072R | Active Recombinant Rat TIMP1 Protein | +Inquiry |
Timp1-1798R | Recombinant Rat TIMP Metallopeptidase Inhibitor 1 | +Inquiry |
TIMP1-2791R | Recombinant Rabbit TIMP1 protein, His-tagged | +Inquiry |
TIMP1-2786D | Recombinant Dog TIMP1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMP1-2376MCL | Recombinant Mouse TIMP1 cell lysate | +Inquiry |
TIMP1-1490RCL | Recombinant Rat TIMP1 cell lysate | +Inquiry |
TIMP1-2678HCL | Recombinant Human TIMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIMP1 Products
Required fields are marked with *
My Review for All TIMP1 Products
Required fields are marked with *