Recombinant Human TLN1 Protein (92-399 aa), His-tagged
Cat.No. : | TLN1-1737H |
Product Overview : | Recombinant Human TLN1 Protein (92-399 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 92-399 aa |
Description : | Probably involved in connections of major cytoskeletal structures to the plasma mbrane. High molecular weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDII |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TLN1 talin 1 [ Homo sapiens ] |
Official Symbol | TLN1 |
Synonyms | TLN1; talin 1; TLN; talin-1; ILWEQ; KIAA1027; |
Gene ID | 7094 |
mRNA Refseq | NM_006289 |
Protein Refseq | NP_006280 |
MIM | 186745 |
UniProt ID | Q9Y490 |
◆ Recombinant Proteins | ||
TLN1-4982H | Recombinant Human TLN1 protein, GST-tagged | +Inquiry |
TLN1-354H | Recombinant Human TLN1 Protein, His-tagged | +Inquiry |
TLN1-6092C | Recombinant Chicken TLN1 | +Inquiry |
TLN1-16819M | Recombinant Mouse TLN1 Protein | +Inquiry |
TLN1-1737H | Recombinant Human TLN1 Protein (92-399 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLN1 Products
Required fields are marked with *
My Review for All TLN1 Products
Required fields are marked with *
0
Inquiry Basket