Recombinant Human TMPRSS2 Protein(256-492aa), GST-tagged

Cat.No. : TMPRSS2-05944H
Product Overview : Recombinant Human TMPRSS2 Protein(256-492aa)(O15393), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 256-492aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.7 kDa
AA Sequence : IVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TMPRSS2 transmembrane protease, serine 2 [ Homo sapiens ]
Official Symbol TMPRSS2
Synonyms TMPRSS2; transmembrane protease, serine 2; transmembrane protease serine 2; PRSS10; epitheliasin; serine protease 10; PP9284; FLJ41954;
Gene ID 7113
mRNA Refseq NM_001135099
Protein Refseq NP_001128571
MIM 602060
UniProt ID O15393

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMPRSS2 Products

Required fields are marked with *

My Review for All TMPRSS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon