Recombinant Human TNFRSF10B Protein, His-tagged
Cat.No. : | TNFRSF10B-309H |
Product Overview : | Recombinant Human TNFRSF10B, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Molecular Mass : | 15.19kD |
AA Sequence : | ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKEVDHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TNFRSF10B tumor necrosis factor receptor superfamily, member 10b [ Homo sapiens ] |
Official Symbol | TNFRSF10B |
Synonyms | TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB; Fas-like protein; death receptor 5; cytotoxic TRAIL receptor-2; apoptosis inducing receptor TRAIL-R2; apoptosis inducing protein TRICK2A/2B; TNF-related apoptosis-inducing ligand receptor 2; death domain containing receptor for TRAIL/Apo-2L; tumor necrosis factor receptor-like protein ZTNFR9; p53-regulated DNA damage-inducible cell death receptor(killer); TRICK2; ZTNFR9; TRAILR2; TRICK2B; TRAIL-R2; KILLER/DR5; |
Gene ID | 8795 |
mRNA Refseq | NM_003842 |
Protein Refseq | NP_003833 |
MIM | 603612 |
UniProt ID | O14763 |
◆ Recombinant Proteins | ||
Tnfrsf10b-3292MF | Recombinant Mouse Tnfrsf10b Protein, His-tagged, FITC conjugated | +Inquiry |
TNFRSF10B-1639R | Recombinant Rhesus Monkey TNFRSF10B Protein, hIgG4-tagged | +Inquiry |
Tnfrsf10b-3292MAF555 | Recombinant Mouse Tnfrsf10b Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF10B-28127TH | Recombinant Human TNFRSF10B, Fc-tagged | +Inquiry |
TNFRSF10B-56H | Active Recombinant Human TNFRSF10B protein, Fc-tagged, FITC-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF10B-2397MCL | Recombinant Mouse TNFRSF10B cell lysate | +Inquiry |
TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF10B Products
Required fields are marked with *
My Review for All TNFRSF10B Products
Required fields are marked with *