Recombinant Human TNFRSF10B Protein, His-tagged
| Cat.No. : | TNFRSF10B-309H |
| Product Overview : | Recombinant Human TNFRSF10B, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene. |
| Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Molecular Mass : | 15.19kD |
| AA Sequence : | ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKEVDHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | TNFRSF10B tumor necrosis factor receptor superfamily, member 10b [ Homo sapiens ] |
| Official Symbol | TNFRSF10B |
| Synonyms | TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB; Fas-like protein; death receptor 5; cytotoxic TRAIL receptor-2; apoptosis inducing receptor TRAIL-R2; apoptosis inducing protein TRICK2A/2B; TNF-related apoptosis-inducing ligand receptor 2; death domain containing receptor for TRAIL/Apo-2L; tumor necrosis factor receptor-like protein ZTNFR9; p53-regulated DNA damage-inducible cell death receptor(killer); TRICK2; ZTNFR9; TRAILR2; TRICK2B; TRAIL-R2; KILLER/DR5; |
| Gene ID | 8795 |
| mRNA Refseq | NM_003842 |
| Protein Refseq | NP_003833 |
| MIM | 603612 |
| UniProt ID | O14763 |
| ◆ Recombinant Proteins | ||
| TNFRSF10B-763H | Recombinant Human TNFRSF10B protein, His-Avi-tagged | +Inquiry |
| TNFRSF10B-462H | Recombinant Human TNFRSF10B Protein, His-tagged | +Inquiry |
| Tnfrsf10b-3292MAF488 | Recombinant Mouse Tnfrsf10b Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| Tnfrsf10b-3321MAF647 | Recombinant Mouse Tnfrsf10b Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| TNFRSF10B-28130TH | Recombinant Human TNFRSF10B, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF10B-2829HCL | Recombinant Human TNFRSF10B cell lysate | +Inquiry |
| TNFRSF10B-2397MCL | Recombinant Mouse TNFRSF10B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF10B Products
Required fields are marked with *
My Review for All TNFRSF10B Products
Required fields are marked with *
