Recombinant Human TNFRSF10B Protein, His-tagged

Cat.No. : TNFRSF10B-309H
Product Overview : Recombinant Human TNFRSF10B, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
Molecular Mass : 15.19kD
AA Sequence : ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKEVDHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TNFRSF10B tumor necrosis factor receptor superfamily, member 10b [ Homo sapiens ]
Official Symbol TNFRSF10B
Synonyms TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB; Fas-like protein; death receptor 5; cytotoxic TRAIL receptor-2; apoptosis inducing receptor TRAIL-R2; apoptosis inducing protein TRICK2A/2B; TNF-related apoptosis-inducing ligand receptor 2; death domain containing receptor for TRAIL/Apo-2L; tumor necrosis factor receptor-like protein ZTNFR9; p53-regulated DNA damage-inducible cell death receptor(killer); TRICK2; ZTNFR9; TRAILR2; TRICK2B; TRAIL-R2; KILLER/DR5;
Gene ID 8795
mRNA Refseq NM_003842
Protein Refseq NP_003833
MIM 603612
UniProt ID O14763

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF10B Products

Required fields are marked with *

My Review for All TNFRSF10B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon