Recombinant Human TNFRSF11A Protein, His-tagged

Cat.No. : TNFRSF11A-155H
Product Overview : Recombinant Human TNFRSF11A Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : RANK (receptor activator of NF-κB) is a member of the tumor necrosis factor (TNF) receptor subfamily that is activated by its ligand, RANKL (TRANCE/OPGL/ODF), to promote survival of dendritic cells and differentiation of osteoclasts. Although RANK is widely expressed, its cell surface expression may be more restricted to dendritic cells and foreskin fibroblasts. RANK contains a 383-amino acid intracellular domain that associates with specific members of the TRAF family to NF-κB and JNK activiation. RANKL/RANK signaling may also lead to survival signaling through activation of the Akt pathway and an upregulation of survival proteins, including Bcl-xL. RANK signaling has been implicated as a potential therapeutic to inhibit bone loss and arthritis.
Molecular Mass : ~21 kDa
AA Sequence : MIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name TNFRSF11A tumor necrosis factor receptor superfamily, member 11a, NFKB activator [ Homo sapiens (human) ]
Official Symbol TNFRSF11A
Synonyms TNFRSF11A; tumor necrosis factor receptor superfamily, member 11a, NFKB activator; tumor necrosis factor receptor superfamily, member 11a, activator of NFKB; tumor necrosis factor receptor superfamily member 11A; CD265; RANK; receptor activator of NF-KB; osteoclast differentiation factor receptor; receptor activator of nuclear factor-kappa B; loss of heterozygosity, 18, chromosomal region 1; FEO; OFE; ODFR; OSTS; PDB2; OPTB7; TRANCER; LOH18CR1;
Gene ID 8792
mRNA Refseq NM_003839
Protein Refseq NP_003830
MIM 603499
UniProt ID Q9Y6Q6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF11A Products

Required fields are marked with *

My Review for All TNFRSF11A Products

Required fields are marked with *

0
cart-icon