Recombinant Human TNFRSF12A protein
Cat.No. : | TNFRSF12A-582H |
Product Overview : | Recombinant Human TNFRSF12A protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 53 |
Description : | Human TNF-related weak inducer of apoptosis receptor (TWEAKR) also known as Tumor necrosis factor receptor superfamily member 12A precursor (gene name TNFRSF12A) or fibroblast growth factor-inducable 14 kD protein, is distantly related to the TNFR family, containing one cysteine-rich domain in the extracellular region and a TNFR-associated factor binding domain but does not contain a death domain (DD) cytoplasmic region. It is expressed in the spleen, thymus, peripheral blood lymphocytes, colon, and small intestine. Signal transduction by TWEAK receptor can be activated by either the membrane anchored or the soluble TWEAK. In addition, It plays a role in TWEAK-induced endothelial cell migration, proliferation, and angiogenesis. Human and mouse TWEAK R share 82 % a.a. sequence identity. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inhibiting TWEAK-dependent proliferation of human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 × 10⁴ IU/mg, in the presence of 15 ng/ml of rHuTWEAK. |
Molecular Mass : | Approximately 5.6 kDa, a single non-glycosylated polypeptide chain containing 53 amino acids. |
AA Sequence : | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWP |
Endotoxin : | Less than 1 EU/μg of rHuTWEAK Receptor as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF12A |
Official Symbol | TNFRSF12A |
Synonyms | TNFRSF12A; tumor necrosis factor receptor superfamily, member 12A; tumor necrosis factor receptor superfamily member 12A; CD266; FN14; TweakR; tweak-receptor; FGF-inducible 14; type I transmembrane protein Fn14; fibroblast growth factor-inducible immediate-early response protein 14; TWEAKR; |
Gene ID | 51330 |
mRNA Refseq | NM_016639 |
Protein Refseq | NP_057723 |
MIM | 605914 |
UniProt ID | Q9NP84 |
◆ Recombinant Proteins | ||
TNFRSF12A-151H | Recombinant Human TNFRSF12A Protein, DYKDDDDK-tagged | +Inquiry |
TNFRSF12A-709H | Active Recombinant Human TNFRSF12A, Fc-tagged, Biotinylated | +Inquiry |
Tnfrsf12a-3533M | Recombinant Mouse Tnfrsf12a protein, hFc-tagged | +Inquiry |
Tnfrsf12a-2085M | Recombinant Mouse Tnfrsf12a, Fc Chimera | +Inquiry |
TNFRSF12A-2125H | Recombinant Human TNFRSF12A Protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF12A-1560HCL | Recombinant Human TNFRSF12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF12A Products
Required fields are marked with *
My Review for All TNFRSF12A Products
Required fields are marked with *
0
Inquiry Basket