Recombinant Human TNFRSF12A Protein, Fc-tagged
Cat.No. : | TNFRSF12A-471H |
Product Overview : | Recombinant human TNFRSF12A protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 129 |
Description : | Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane. |
Form : | Lyophilized |
Molecular Mass : | 33 kDa |
AA Sequence : | MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | TNFRSF12A tumor necrosis factor receptor superfamily, member 12A [ Homo sapiens (human) ] |
Official Symbol | TNFRSF12A |
Synonyms | TNFRSF12A; tumor necrosis factor receptor superfamily, member 12A; tumor necrosis factor receptor superfamily member 12A; CD266; FN14; TweakR; tweak-receptor; FGF-inducible 14; type I transmembrane protein Fn14; fibroblast growth factor-inducible immediate-early response protein 14; TWEAKR; |
Gene ID | 51330 |
mRNA Refseq | NM_016639 |
Protein Refseq | NP_057723 |
MIM | 605914 |
UniProt ID | Q9NP84 |
◆ Recombinant Proteins | ||
TNFRSF12A-441H | Recombinant Human TNFRSF12A Protein, His&GST-tagged | +Inquiry |
TNFRSF12A-312H | Recombinant Active Human TNFRSF12A Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
Tnfrsf12a-3533M | Recombinant Mouse Tnfrsf12a protein, hFc-tagged | +Inquiry |
TNFRSF12A-709H | Active Recombinant Human TNFRSF12A, Fc-tagged, Biotinylated | +Inquiry |
TNFRSF12A-151H | Recombinant Human TNFRSF12A Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF12A-1560HCL | Recombinant Human TNFRSF12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF12A Products
Required fields are marked with *
My Review for All TNFRSF12A Products
Required fields are marked with *
0
Inquiry Basket