Recombinant Human TNFRSF12A Protein, Fc-tagged

• Cat.No.: TNFRSF12A-471H
• Product Overview: Recombinant human TNFRSF12A protein with Fc tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 129
• Description: Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane.
• Form: Lyophilized
• Molecular Mass: 33 kDa
• AA Sequence: MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TNFRSF12A tumor necrosis factor receptor superfamily, member 12A [ Homo sapiens (human) ]
• Official Symbol: TNFRSF12A
• Synonyms: TNFRSF12A; tumor necrosis factor receptor superfamily, member 12A; tumor necrosis factor receptor superfamily member 12A; CD266; FN14; TweakR; tweak-receptor; FGF-inducible 14; type I transmembrane protein Fn14; fibroblast growth factor-inducible immediate-early response protein 14; TWEAKR
• Gene ID: 51330
• mRNA Refseq: NM_016639
• Protein Refseq: NP_057723
• MIM: 605914
• UniProt ID: Q9NP84