Recombinant Human TNFRSF12A Protein, Fc-tagged

Cat.No. : TNFRSF12A-471H
Product Overview : Recombinant human TNFRSF12A protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 129
Description : Involved in positive regulation of extrinsic apoptotic signaling pathway and regulation of wound healing. Predicted to be located in cell surface and ruffle. Predicted to be active in plasma membrane.
Form : Lyophilized
Molecular Mass : 33 kDa
AA Sequence : MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name TNFRSF12A tumor necrosis factor receptor superfamily, member 12A [ Homo sapiens (human) ]
Official Symbol TNFRSF12A
Synonyms TNFRSF12A; tumor necrosis factor receptor superfamily, member 12A; tumor necrosis factor receptor superfamily member 12A; CD266; FN14; TweakR; tweak-receptor; FGF-inducible 14; type I transmembrane protein Fn14; fibroblast growth factor-inducible immediate-early response protein 14; TWEAKR;
Gene ID 51330
mRNA Refseq NM_016639
Protein Refseq NP_057723
MIM 605914
UniProt ID Q9NP84

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF12A Products

Required fields are marked with *

My Review for All TNFRSF12A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon