Recombinant Human TNFRSF13C protein

Cat.No. : TNFRSF13C-39H
Product Overview : Recombinant Human TNFRSF13C protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 76
Description : B Cell Activating Factor Receptor (BAFF-R), also named tumor necrosis factor receptor superfamily member 13C, is a member of the TNFR superfamily. It is highly expressed in spleen, lymph node, and resting B cells and to some extent in activated B cells, resting CD4+ cells and peripheral blood leukocytes. BAFF receptor is a type III transmembrane protein containing a single extracellular phenylalanine-rich domain and binds with high specificity to BAFF (TNFSF13B). It enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. BAFF receptor/BAFF signaling plays a critical role in B cell survival and maturation.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 8.0, 500 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by its ability to block BAFF induced mouse splenocyte survival is 1.0-5.0 μg/ml in the presence of 1.0 μg/ml of rHuBAFF.
Molecular Mass : Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids.
AA Sequence : MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG
Endotoxin : Less than 1 EU/μg of rHuBAFF-R as determined by LAL method.
Purity : >95% by reduced SDS-PAGE analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TNFRSF13C
Official Symbol TNFRSF13C
Synonyms TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235;
Gene ID 115650
mRNA Refseq NM_052945
Protein Refseq NP_443177
MIM 606269
UniProt ID Q96RJ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF13C Products

Required fields are marked with *

My Review for All TNFRSF13C Products

Required fields are marked with *

0
cart-icon