Recombinant Human TNFRSF13C protein
Cat.No. : | TNFRSF13C-39H |
Product Overview : | Recombinant Human TNFRSF13C protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 76 |
Description : | B Cell Activating Factor Receptor (BAFF-R), also named tumor necrosis factor receptor superfamily member 13C, is a member of the TNFR superfamily. It is highly expressed in spleen, lymph node, and resting B cells and to some extent in activated B cells, resting CD4+ cells and peripheral blood leukocytes. BAFF receptor is a type III transmembrane protein containing a single extracellular phenylalanine-rich domain and binds with high specificity to BAFF (TNFSF13B). It enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. BAFF receptor/BAFF signaling plays a critical role in B cell survival and maturation. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 8.0, 500 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to block BAFF induced mouse splenocyte survival is 1.0-5.0 μg/ml in the presence of 1.0 μg/ml of rHuBAFF. |
Molecular Mass : | Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids. |
AA Sequence : | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG |
Endotoxin : | Less than 1 EU/μg of rHuBAFF-R as determined by LAL method. |
Purity : | >95% by reduced SDS-PAGE analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF13C |
Official Symbol | TNFRSF13C |
Synonyms | TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor; CVID4; BAFF-R; BROMIX; prolixin; MGC138235; |
Gene ID | 115650 |
mRNA Refseq | NM_052945 |
Protein Refseq | NP_443177 |
MIM | 606269 |
UniProt ID | Q96RJ3 |
◆ Recombinant Proteins | ||
TNFRSF13C-2910H | Active Recombinant Human TNFRSF13C protein, Fc-tagged | +Inquiry |
Tnfrsf13c-217M | Recombinant Mouse Tnfrsf13c protein, His/S-tagged | +Inquiry |
TNFRSF13C-27432TH | Recombinant Human TNFRSF13C, Fc-tagged | +Inquiry |
TNFRSF13C-319C | Active Recombinant Cynomolgus TNFRSF13C protein, His-tagged | +Inquiry |
TNFRSF13C-1362H | Acitve Recombinant Human TNFRSF13C protein(Arg2-Ala71), hFc&Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF13C-1861MCL | Recombinant Mouse TNFRSF13C cell lysate | +Inquiry |
TNFRSF13C-831RCL | Recombinant Rat TNFRSF13C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF13C Products
Required fields are marked with *
My Review for All TNFRSF13C Products
Required fields are marked with *
0
Inquiry Basket