Recombinant Human TNFRSF18 Protein, C-His-tagged
Cat.No. : | TNFRSF18-154H |
Product Overview : | Recombinant Human TNFRSF18 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | TNFRSF18, also known as glucocorticoid-induced tumor necrosis factor-receptor (TNFR)-related protein (GITR) and activation-inducible TNFR family receptor, encodes a type 1 membrane protein of the TNF-receptor superfamily. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. GITR is an immune cell co-stimulatory receptor expressed constitutively at high levels on CD4+CD25+ T regulatory cells (Tregs), at low levels on naïve and memory T cells, and is induced upon T cell activation. Studies show GITR can also be induced on NK cells, macrophages, and DCs. Although GITR does not have intrinsic enzymatic activity, TNFSF18 (also known as GITRL) expressed on antigen presenting cells binds to GITR, resulting in recruitment of TNFR-associated factor family members and activation of the NF-κB pathway in T cells. GITR ligation has been shown to play a role in CD8+ T cell activation, cytotoxicity, and memory T cell survival. In the thymus, GITR is thought to play a key role in dominant immunological self-tolerance through thymic Treg differentiation and expansion. Of note, GITR ligation inhibits Treg suppressive function and promotes effector T cell resistance to Treg suppression. Due to the combined effects on both Treg suppression and effector cell activation, GITR represents a unique opportunity for immunotherapeutic intervention in cancer. |
Molecular Mass : | ~15 kDa |
AA Sequence : | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | TNFRSF18 tumor necrosis factor receptor superfamily, member 18 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF18 |
Synonyms | TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; AITR; CD357; GITR; activation-inducible TNFR family receptor; glucocorticoid-induced TNFR-related protein; TNF receptor superfamily activation-inducible protein; GITR-D; |
Gene ID | 8784 |
mRNA Refseq | NM_004195 |
Protein Refseq | NP_004186 |
MIM | 603905 |
UniProt ID | Q9Y5U5 |
◆ Recombinant Proteins | ||
TNFRSF18-1480R | Recombinant Rhesus macaque TNFRSF18 protein, Fc-tagged | +Inquiry |
TNFRSF18-661H | Recombinant Human TNFRSF18 Protein | +Inquiry |
TNFRSF18-154H | Recombinant Human TNFRSF18 Protein, C-His-tagged | +Inquiry |
Tnfrsf18-8735RAF488 | Recombinant Rat Tnfrsf18 Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFRSF18-051H | Active Recombinant Human TNFRSF18 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF18-1143HCL | Recombinant Human TNFRSF18 cell lysate | +Inquiry |
TNFRSF18-1245RCL | Recombinant Rat TNFRSF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF18 Products
Required fields are marked with *
My Review for All TNFRSF18 Products
Required fields are marked with *
0
Inquiry Basket