Recombinant Human TNFRSF1B protein, GST-tagged
Cat.No. : | TNFRSF1B-3600H |
Product Overview : | Recombinant Human TNFRSF1B protein(P20333)(27-203aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 27-203aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.3 kDa |
AA Sequence : | VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TNFRSF1B tumor necrosis factor receptor superfamily, member 1B [ Homo sapiens ] |
Official Symbol | TNFRSF1B |
Synonyms | TNFRSF1B; tumor necrosis factor receptor superfamily, member 1B; TNFR2; tumor necrosis factor receptor superfamily member 1B; CD120b; p75; TNF R II; TNF R75; TNFBR; TNFR80; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; soluble TNFR1B variant 1; tumor necrosis factor receptor 2; tumor necrosis factor beta receptor; tumor necrosis factor receptor type II; tumor necrosis factor binding protein 2; TBPII; TNFR1B; TNF-R75; p75TNFR; TNF-R-II; |
Gene ID | 7133 |
mRNA Refseq | NM_001066 |
Protein Refseq | NP_001057 |
MIM | 191191 |
UniProt ID | P20333 |
◆ Recombinant Proteins | ||
TNFRSF1B-7055H | Recombinant Human TNFRSF1B protein, His & GST-tagged | +Inquiry |
TNFRSF1B-194H | Recombinant Mouse TNFRSF1B(Val23-Gly258) Protein, C-6*His-Avi-tagged, Biotinylated | +Inquiry |
TNFRSF1B-1261H | Recombinant Human TNFRSF1B protein, His-tagged | +Inquiry |
TNFRSF1B-211H | Recombinant Human TNFRSF1B Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF1B-193H | Active Recombinant Human TNFRSF1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1B-851HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-1048CCL | Recombinant Cynomolgus TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-2632HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
TNFRSF1B-2192MCL | Recombinant Mouse TNFRSF1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF1B Products
Required fields are marked with *
My Review for All TNFRSF1B Products
Required fields are marked with *
0
Inquiry Basket