Recombinant Human TNFRSF4 protein, hFc-Myc-tagged
Cat.No. : | TNFRSF4-7475H |
Product Overview : | Recombinant Human TNFRSF4 protein(P43489)(29-216aa), fused with C-terminal hFc and Myc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&Myc |
Protein Length : | 29-216aa |
Tag : | C-hFc-Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.3 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor; |
Gene ID | 7293 |
mRNA Refseq | NM_003327 |
Protein Refseq | NP_003318 |
MIM | 600315 |
UniProt ID | P43489 |
◆ Recombinant Proteins | ||
TNFRSF4-152H | Recombinant Human TNFRSF4 Protein, DYKDDDDK-tagged | +Inquiry |
TNFRSF4-3247HAF647 | Recombinant Human TNFRSF4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFRSF4-5155H | Recombinant Human TNFRSF4 Protein (Leu29-Ala216), C-Fc tagged | +Inquiry |
TNFRSF4-2221H | Recombinant Human TNFRSF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF4-103M | Active Recombinant Cynomolgus/Rhesus macaque TNFRSF4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
0
Inquiry Basket