Recombinant Human TNFRSF4 protein, hFc-Myc-tagged
| Cat.No. : | TNFRSF4-7475H |
| Product Overview : | Recombinant Human TNFRSF4 protein(P43489)(29-216aa), fused with C-terminal hFc and Myc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&Myc |
| Protein Length : | 29-216aa |
| Tag : | C-hFc-Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 49.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
| Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
| Official Symbol | TNFRSF4 |
| Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor; |
| Gene ID | 7293 |
| mRNA Refseq | NM_003327 |
| Protein Refseq | NP_003318 |
| MIM | 600315 |
| UniProt ID | P43489 |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
| TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *



