Recombinant Human TNFRSF4 protein, hFc-Myc-tagged

• Cat.No.: TNFRSF4-7475H
• Product Overview: Recombinant Human TNFRSF4 protein(P43489)(29-216aa), fused with C-terminal hFc and Myc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&Myc
• Protein Length: 29-216aa
• Tag: C-hFc-Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

Gene Information

• Gene Name: TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
• Official Symbol: TNFRSF4
• Synonyms: TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor
• Gene ID: 7293
• mRNA Refseq: NM_003327
• Protein Refseq: NP_003318
• MIM: 600315
• UniProt ID: P43489