Recombinant Human TNFSF12 protein, His-SUMO-tagged

Cat.No. : TNFSF12-3605H
Product Overview : Recombinant Human TNFSF12 protein(O43508)(43-249aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 43-249aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.9 kDa
AA Sequence : SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TNFSF12 tumor necrosis factor (ligand) superfamily, member 12 [ Homo sapiens ]
Official Symbol TNFSF12
Synonyms TNFSF12; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand superfamily member 12; APO3L; DR3LG; TWEAK; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; MGC20669; MGC129581;
Gene ID 8742
mRNA Refseq NM_003809
Protein Refseq NP_003800
MIM 602695
UniProt ID O43508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF12 Products

Required fields are marked with *

My Review for All TNFSF12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon