Recombinant Human TNFSF12 protein, His-SUMO-tagged
Cat.No. : | TNFSF12-3605H |
Product Overview : | Recombinant Human TNFSF12 protein(O43508)(43-249aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 43-249aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TNFSF12 tumor necrosis factor (ligand) superfamily, member 12 [ Homo sapiens ] |
Official Symbol | TNFSF12 |
Synonyms | TNFSF12; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand superfamily member 12; APO3L; DR3LG; TWEAK; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; MGC20669; MGC129581; |
Gene ID | 8742 |
mRNA Refseq | NM_003809 |
Protein Refseq | NP_003800 |
MIM | 602695 |
UniProt ID | O43508 |
◆ Recombinant Proteins | ||
TNFSF12-4686R | Recombinant Rhesus Macaque TNFSF12 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF12-3216H | Recombinant Human TNFSF12 Protein (Asp65-Gln247), His tagged | +Inquiry |
TNFSF12-305H | Active Recombinant Human TNFSF12 Protein (Lys56-His249), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TNFSF12-9483M | Recombinant Mouse TNFSF12 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF12-8822C | Recombinant Cynomolgus TNFSF12, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF12-1155CCL | Recombinant Cynomolgus TNFSF12 cell lysate | +Inquiry |
TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF12 Products
Required fields are marked with *
My Review for All TNFSF12 Products
Required fields are marked with *
0
Inquiry Basket