Recombinant Human TNFSF12 protein, His-SUMO-tagged
| Cat.No. : | TNFSF12-3605H |
| Product Overview : | Recombinant Human TNFSF12 protein(O43508)(43-249aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 43-249aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38.9 kDa |
| AA Sequence : | SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TNFSF12 tumor necrosis factor (ligand) superfamily, member 12 [ Homo sapiens ] |
| Official Symbol | TNFSF12 |
| Synonyms | TNFSF12; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand superfamily member 12; APO3L; DR3LG; TWEAK; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; MGC20669; MGC129581; |
| Gene ID | 8742 |
| mRNA Refseq | NM_003809 |
| Protein Refseq | NP_003800 |
| MIM | 602695 |
| UniProt ID | O43508 |
| ◆ Recombinant Proteins | ||
| TNFSF12-8822C | Recombinant Cynomolgus TNFSF12, Fc tagged | +Inquiry |
| Tnfsf12-983M | Active Recombinant Mouse Tnfsf12 Protein, Met & His-tagged | +Inquiry |
| RFL27494HF | Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 12(Tnfsf12) Protein, His-Tagged | +Inquiry |
| TNFSF12-70H | Active Recombinant Human TWEAK, FLAG-tagged | +Inquiry |
| TNFSF12-0261R | Active Recombinant Rat TNFSF12 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFSF12-1204RCL | Recombinant Rat TNFSF12 cell lysate | +Inquiry |
| TNFSF12-1155CCL | Recombinant Cynomolgus TNFSF12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF12 Products
Required fields are marked with *
My Review for All TNFSF12 Products
Required fields are marked with *



