Recombinant Human TNFSF12 protein, His-SUMO-tagged

• Cat.No.: TNFSF12-3605H
• Product Overview: Recombinant Human TNFSF12 protein(O43508)(43-249aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 43-249aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.9 kDa
• AA Sequence: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TNFSF12 tumor necrosis factor (ligand) superfamily, member 12 [ Homo sapiens ]
• Official Symbol: TNFSF12
• Synonyms: TNFSF12; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand superfamily member 12; APO3L; DR3LG; TWEAK; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; MGC20669; MGC129581
• Gene ID: 8742
• mRNA Refseq: NM_003809
• Protein Refseq: NP_003800
• MIM: 602695
• UniProt ID: O43508