Recombinant Human TNFSF18 Protein, His-tagged

Cat.No. : TNFSF18-882H
Product Overview : Recombinant Human TNFSF18 fused with His tag at C-terminal was expressed in HEK293 cells.
Availability February 04, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH7.5
Molecular Mass : 15.3kD
AA Sequence : ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens ]
Official Symbol TNFSF18
Synonyms TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237;
Gene ID 8995
mRNA Refseq NM_005092
Protein Refseq NP_005083
MIM 603898
UniProt ID Q9UNG2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF18 Products

Required fields are marked with *

My Review for All TNFSF18 Products

Required fields are marked with *

0
cart-icon
0
compare icon