Recombinant Human TNFSF18 Protein, His-tagged
Cat.No. : | TNFSF18-882H |
Product Overview : | Recombinant Human TNFSF18 fused with His tag at C-terminal was expressed in HEK293 cells. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH7.5 |
Molecular Mass : | 15.3kD |
AA Sequence : | ETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | TNFSF18 tumor necrosis factor (ligand) superfamily, member 18 [ Homo sapiens ] |
Official Symbol | TNFSF18 |
Synonyms | TNFSF18; tumor necrosis factor (ligand) superfamily, member 18; tumor necrosis factor ligand superfamily member 18; AITRL; hGITRL; TL6; AITR ligand; GITR ligand; activation-inducible TNF-related ligand; glucocorticoid-induced TNF-related ligand; glucocorticoid-induced TNFR-related protein ligand; GITRL; MGC138237; |
Gene ID | 8995 |
mRNA Refseq | NM_005092 |
Protein Refseq | NP_005083 |
MIM | 603898 |
UniProt ID | Q9UNG2 |
◆ Recombinant Proteins | ||
TNFSF18-311H | Active Recombinant Human TNFSF18 Protein (Gln50-Ile176), C-His tagged, Animal-free, Carrier-free | +Inquiry |
TNFSF18-603H | Recombinant Human TNFSF18 Protein (Gln50-Ser177), N-mFc and C-6×His-tagged | +Inquiry |
TNFSF18-1507M | Active Recombinant Mouse TNFSF18 protein, Fc-tagged | +Inquiry |
Tnfsf18-408M | Active Recombinant Mouse Tnfsf18, His-tagged | +Inquiry |
TNFSF18-722H | Recombinant Human TNFSF18 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF18-890HCL | Recombinant Human TNFSF18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *