Recombinant Human TNNI3 protein, His-tagged
Cat.No. : | TNNI3-52H |
Product Overview : | Recombinant Human Cardiac Troponin I fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa. |
Molecular Mass : | 24kD |
AA Sequence : | MKKGHHHHHHLVPRGSMADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIF DLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKK FES |
Purity : | Greater than 95% by SDS-PAGE gel analyses. |
Applications : | Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies. |
Storage : | - 20°C for Lyophilized, - 80°C for Liquid |
Gene Name | TNNI3 troponin I type 3 (cardiac) [ Homo sapiens ] |
Official Symbol | TNNI3 |
Synonyms | TNNI3; troponin I type 3 (cardiac); troponin I, cardiac; troponin I, cardiac muscle; CMH7; TNNC1; RCM1; cTnI; CMD2A; CMD1FF; MGC116817; |
Gene ID | 7137 |
mRNA Refseq | NM_000363 |
Protein Refseq | NP_000354 |
MIM | 191044 |
UniProt ID | P19429 |
Chromosome Location | 19q13.4 |
Pathway | Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; Hypertrophic cardiomyopathy (HCM), conserved biosystem; Muscle contraction, organism-specific biosystem; |
Function | actin binding; calcium channel inhibitor activity; calcium-dependent protein binding; protein binding; protein domain specific binding; protein kinase binding; troponin C binding; troponin T binding; |
◆ Recombinant Proteins | ||
TNNI3-5866R | Recombinant Rat TNNI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tnni3-2676R | Recombinant Rat Tnni3 protein, His-tagged | +Inquiry |
TNNI3-31690TH | Recombinant Human TNNI3 | +Inquiry |
TNNI3-535C | Recombinant Cat TNNI3 protein, His-tagged | +Inquiry |
TNNI3-2682H | Recombinant Human TNNI3 protein(61-130 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
TNNI3-221H | Native Human TNNI3 | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
TNNI3-223H | Native Human Troponin I Type 3 (Cardiac) | +Inquiry |
Tnni3-7423M | Native Mouse Tnni3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNI3-1803HCL | Recombinant Human TNNI3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNI3 Products
Required fields are marked with *
My Review for All TNNI3 Products
Required fields are marked with *