"TNNI3" Related Products

Expand
Expand

Recombinant Human TNNI3 protein, His-tagged

Cat.No.: TNNI3-52H
Product Overview: Recombinant Human Cardiac Troponin I fused with His tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: lyophilized from a 0.2um filtered solution in PBS, pH7.4 with 5% trehalose and 0.01% thimerosa.
Molecular Mass: 24kD
AA Sequence: MKKGHHHHHHLVPRGSMADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTKNITEIADLTQKIF DLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKK FES
Purity: Greater than 95% by SDS-PAGE gel analyses.
Applications: Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage: - 20°C for Lyophilized, - 80°C for Liquid
Gene Name: TNNI3 troponin I type 3 (cardiac) [ Homo sapiens ]
Official Symbol: TNNI3
Synonyms: TNNI3; troponin I type 3 (cardiac); troponin I, cardiac; troponin I, cardiac muscle; CMH7; TNNC1; RCM1; cTnI; CMD2A; CMD1FF; MGC116817;
Gene ID: 7137
mRNA Refseq: NM_000363
Protein Refseq: NP_000354
MIM: 191044
UniProt ID: P19429
Chromosome Location: 19q13.4
Pathway: Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; Hypertrophic cardiomyopathy (HCM), conserved biosystem; Muscle contraction, organism-specific biosystem;
Function: actin binding; calcium channel inhibitor activity; calcium-dependent protein binding; protein binding; protein domain specific binding; protein kinase binding; troponin C binding; troponin T binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.