Recombinant Human TP53BP1 protein, His-tagged
Cat.No. : | TP53BP1-3822H |
Product Overview : | Recombinant Human TP53BP1 protein(301-418 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 301-418 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TP53BP1 tumor protein p53 binding protein 1 [ Homo sapiens ] |
Official Symbol | TP53BP1 |
Synonyms | TP53BP1; tumor protein p53 binding protein 1; tumor protein p53 binding protein, 1; tumor suppressor p53-binding protein 1; 53BP1; p202; p53BP1; p53-binding protein 1; tumor protein 53-binding protein, 1; tumor protein p53-binding protein, 1; FLJ41424; MGC138366; |
Gene ID | 7158 |
mRNA Refseq | NM_001141979 |
Protein Refseq | NP_001135451 |
MIM | 605230 |
UniProt ID | Q12888 |
◆ Recombinant Proteins | ||
TP53BP1-1891HFL | Recombinant Full Length Human TP53BP1 Protein, C-Flag-tagged | +Inquiry |
TP53BP1-641H | Recombinant Human TP53BP1 Protein, His-tagged | +Inquiry |
TP53BP1-001H | Recombinant Human tumor protein p53 binding protein 1 Protein, His tagged | +Inquiry |
TP53BP1-5803H | Recombinant Human TP53BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TP53BP1-2302H | Recombinant Human TP53BP1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53BP1 Products
Required fields are marked with *
My Review for All TP53BP1 Products
Required fields are marked with *