Recombinant Human TP53BP1 protein, His-tagged
| Cat.No. : | TP53BP1-3822H |
| Product Overview : | Recombinant Human TP53BP1 protein(301-418 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 20, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 301-418 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | TP53BP1 tumor protein p53 binding protein 1 [ Homo sapiens ] |
| Official Symbol | TP53BP1 |
| Synonyms | TP53BP1; tumor protein p53 binding protein 1; tumor protein p53 binding protein, 1; tumor suppressor p53-binding protein 1; 53BP1; p202; p53BP1; p53-binding protein 1; tumor protein 53-binding protein, 1; tumor protein p53-binding protein, 1; FLJ41424; MGC138366; |
| Gene ID | 7158 |
| mRNA Refseq | NM_001141979 |
| Protein Refseq | NP_001135451 |
| MIM | 605230 |
| UniProt ID | Q12888 |
| ◆ Recombinant Proteins | ||
| TP53BP1-6498H | Recombinant Human TP53BP1 Protein (Ala1614-His1972), N-His tagged | +Inquiry |
| TP53BP1-26025TH | Recombinant Human TP53BP1, His-tagged | +Inquiry |
| TP53BP1-2236H | Recombinant Human TP53BP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TP53BP1-1891HFL | Recombinant Full Length Human TP53BP1 Protein, C-Flag-tagged | +Inquiry |
| TP53BP1-3822H | Recombinant Human TP53BP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53BP1 Products
Required fields are marked with *
My Review for All TP53BP1 Products
Required fields are marked with *



