Recombinant Human TP53BP2 protein, GST-tagged

• Cat.No.: TP53BP2-2679H
• Product Overview: Recombinant Human TP53BP2 protein(273-519 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 273-519 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TP53BP2 tumor protein p53 binding protein, 2 [ Homo sapiens ]
• Official Symbol: TP53BP2
• Synonyms: TP53BP2; tumor protein p53 binding protein, 2; apoptosis-stimulating of p53 protein 2; 53BP2; ASPP2; PPP1R13A; BCL2-binding protein; renal carcinoma antigen NY-REN-51; tumor suppressor p53-binding protein 2; apoptosis-stimulating protein of p53, 2; BBP; P53BP2
• Gene ID: 7159
• mRNA Refseq: NM_001031685
• Protein Refseq: NP_001026855
• MIM: 602143
• UniProt ID: Q13625