Recombinant Human TP53BP2 protein, His-tagged

Cat.No. : TP53BP2-2678H
Product Overview : Recombinant Human TP53BP2 protein(273-519 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability December 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 273-519 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name TP53BP2 tumor protein p53 binding protein, 2 [ Homo sapiens ]
Official Symbol TP53BP2
Synonyms TP53BP2; tumor protein p53 binding protein, 2; apoptosis-stimulating of p53 protein 2; 53BP2; ASPP2; PPP1R13A; BCL2-binding protein; renal carcinoma antigen NY-REN-51; tumor suppressor p53-binding protein 2; apoptosis-stimulating protein of p53, 2; BBP; P53BP2;
Gene ID 7159
mRNA Refseq NM_001031685
Protein Refseq NP_001026855
MIM 602143
UniProt ID Q13625

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TP53BP2 Products

Required fields are marked with *

My Review for All TP53BP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon