Recombinant Human TP53BP2 protein, His-tagged
| Cat.No. : | TP53BP2-2678H |
| Product Overview : | Recombinant Human TP53BP2 protein(273-519 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 273-519 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | SSTMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TP53BP2 tumor protein p53 binding protein, 2 [ Homo sapiens ] |
| Official Symbol | TP53BP2 |
| Synonyms | TP53BP2; tumor protein p53 binding protein, 2; apoptosis-stimulating of p53 protein 2; 53BP2; ASPP2; PPP1R13A; BCL2-binding protein; renal carcinoma antigen NY-REN-51; tumor suppressor p53-binding protein 2; apoptosis-stimulating protein of p53, 2; BBP; P53BP2; |
| Gene ID | 7159 |
| mRNA Refseq | NM_001031685 |
| Protein Refseq | NP_001026855 |
| MIM | 602143 |
| UniProt ID | Q13625 |
| ◆ Recombinant Proteins | ||
| TP53BP2-2679H | Recombinant Human TP53BP2 protein, GST-tagged | +Inquiry |
| TP53BP2-2678H | Recombinant Human TP53BP2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53BP2 Products
Required fields are marked with *
My Review for All TP53BP2 Products
Required fields are marked with *
