Recombinant Human TRIM21
Cat.No. : | TRIM21-30033TH |
Product Overview : | Recombinant fragment of Human SSA1 with N terminal proprietary tag; Predicted MWt 37.51 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. |
Protein length : | 108 amino acids |
Molecular Weight : | 37.510kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Isoforms 1 and 2 are expressed in fetal and adult heart and fetal lung. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDG KALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQVALGELR RKQELAEKLEVEIAIKRADWKKTVETQK |
Sequence Similarities : | Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger. |
Gene Name : | TRIM21 tripartite motif containing 21 [ Homo sapiens ] |
Official Symbol : | TRIM21 |
Synonyms : | TRIM21; tripartite motif containing 21; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA1, tripartite motif containing 21; E3 ubiquitin-protein ligase TRIM21; RNF81; RO52; |
Gene ID : | 6737 |
mRNA Refseq : | NM_003141 |
Protein Refseq : | NP_003132 |
MIM : | 109092 |
Uniprot ID : | P19474 |
Chromosome Location : | 11p15.5-p15.3 |
Pathway : | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function : | DNA binding; RNA binding; ligase activity; metal ion binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
TRIM21-11H | Recombinant Human TRIM21 Protein (1-475), C-His-tagged | +Inquiry |
TRIM21-2685H | Recombinant Human TRIM21 protein(81-260 aa), C-His-tagged | +Inquiry |
Trim21-6646M | Recombinant Mouse Trim21 Protein, Myc/DDK-tagged | +Inquiry |
TRIM21-671H | Recombinant Human TRIM21 Protein (Met1-Tyr475), His-tagged | +Inquiry |
TRIM21-4768R | Recombinant Rhesus Macaque TRIM21 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Protein | ||
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Lysates | ||
TRIM21-791HCL | Recombinant Human TRIM21 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket