Recombinant Human TRIM21

Cat.No. : TRIM21-30033TH
Product Overview : Recombinant fragment of Human SSA1 with N terminal proprietary tag; Predicted MWt 37.51 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined.
Molecular Weight : 37.510kDa inclusive of tags
Tissue specificity : Isoforms 1 and 2 are expressed in fetal and adult heart and fetal lung.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QLANMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDG KALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQVALGELR RKQELAEKLEVEIAIKRADWKKTVETQK
Sequence Similarities : Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger.
Gene Name TRIM21 tripartite motif containing 21 [ Homo sapiens ]
Official Symbol TRIM21
Synonyms TRIM21; tripartite motif containing 21; Sjogren syndrome antigen A1 (52kDa, ribonucleoprotein autoantigen SS A/Ro) , SSA1, tripartite motif containing 21; E3 ubiquitin-protein ligase TRIM21; RNF81; RO52;
Gene ID 6737
mRNA Refseq NM_003141
Protein Refseq NP_003132
MIM 109092
Uniprot ID P19474
Chromosome Location 11p15.5-p15.3
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function DNA binding; RNA binding; ligase activity; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM21 Products

Required fields are marked with *

My Review for All TRIM21 Products

Required fields are marked with *

0
cart-icon
0
compare icon