Recombinant Human TRIM24 protein, His-SUMO-tagged

• Cat.No.: TRIM24-3622H
• Product Overview: Recombinant Human TRIM24 protein(O15164)(891-1012aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 891-1012aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.5 kDa
• AA Sequence: KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TRIM24 tripartite motif containing 24 [ Homo sapiens ]
• Official Symbol: TRIM24
• Synonyms: TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA
• Gene ID: 8805
• mRNA Refseq: NM_003852
• Protein Refseq: NP_003843
• MIM: 603406
• UniProt ID: O15164