Recombinant Human TRIM24 protein, His-SUMO-tagged
Cat.No. : | TRIM24-3622H |
Product Overview : | Recombinant Human TRIM24 protein(O15164)(891-1012aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 891-1012aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.5 kDa |
AA Sequence : | KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TRIM24 tripartite motif containing 24 [ Homo sapiens ] |
Official Symbol | TRIM24 |
Synonyms | TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA; |
Gene ID | 8805 |
mRNA Refseq | NM_003852 |
Protein Refseq | NP_003843 |
MIM | 603406 |
UniProt ID | O15164 |
◆ Recombinant Proteins | ||
TRIM24-314H | Recombinant Human TRIM24 protein, His/FLAG-tagged | +Inquiry |
TRIM24-335H | Recombinant Human TRIM24 Protein, Flag-tagged | +Inquiry |
TRIM24-3409H | Recombinant Human TRIM24, His-tagged | +Inquiry |
TRIM24-858Z | Recombinant Zebrafish TRIM24 | +Inquiry |
TRIM24-1546H | Recombinant Human TRIM24 Protein (891-1012 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM24-789HCL | Recombinant Human TRIM24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM24 Products
Required fields are marked with *
My Review for All TRIM24 Products
Required fields are marked with *
0
Inquiry Basket