Recombinant Human TRIM24 protein, His-SUMO-tagged

Cat.No. : TRIM24-3622H
Product Overview : Recombinant Human TRIM24 protein(O15164)(891-1012aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 891-1012aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.5 kDa
AA Sequence : KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TRIM24 tripartite motif containing 24 [ Homo sapiens ]
Official Symbol TRIM24
Synonyms TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA;
Gene ID 8805
mRNA Refseq NM_003852
Protein Refseq NP_003843
MIM 603406
UniProt ID O15164

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM24 Products

Required fields are marked with *

My Review for All TRIM24 Products

Required fields are marked with *

0
cart-icon