Recombinant Human TTR Protein, 21-147aa, F87M and L110M Mutation, N-Trx-His tagged

Cat.No. : TTR-02H
Product Overview : Recombinant Human TTR Protein (21-147aa, F87M and L110M Mutation) with N-Trx-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Trx
Protein Length : 21-147aa
Description : This gene encodes one of the three prealbumins, which include alpha-1-antitrypsin, transthyretin and orosomucoid. The encoded protein, transthyretin, is a homo-tetrameric carrier protein, which transports thyroid hormones in the plasma and cerebrospinal fluid. It is also involved in the transport of retinol (vitamin A) in the plasma by associating with retinol-binding protein. The protein may also be involved in other intracellular processes including proteolysis, nerve regeneration, autophagy and glucose homeostasis. Mutations in this gene are associated with amyloid deposition, predominantly affecting peripheral nerves or the heart, while a small percentage of the gene mutations are non-amyloidogenic. The mutations are implicated in the etiology of several diseases, including amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis and carpal tunnel syndrome.
Form : Liquid
Molecular Mass : ~ 30kDa
AA Sequence : MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE*
Purity : > 85% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 4.37 mg/mL
Storage Buffer : In 140 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 , pH8.0.
Gene Name TTR transthyretin [ Homo sapiens (human) ]
Official Symbol TTR
Synonyms TTR; transthyretin; PALB, prealbumin, amyloidosis type I; HsT2651; ATTR; carpal tunnel syndrome 1; thyroxine-binding prealbumin; prealbumin, amyloidosis type I; CTS; CTS1; PALB; TBPA
Gene ID 7276
mRNA Refseq NM_000371
Protein Refseq NP_000362
MIM 176300
UniProt ID P02766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TTR Products

Required fields are marked with *

My Review for All TTR Products

Required fields are marked with *

0
cart-icon