Recombinant Human UBASH3A protein, GST-tagged
| Cat.No. : | UBASH3A-3521H |
| Product Overview : | Recombinant Human UBASH3A protein(1-344 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-344 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAAGETQLYAKVSNKLKGRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEASLLADCSVKPCTKQLHLTLAHKFYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLNSRKDGEASSRCSGEFLPQTARS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | UBASH3A ubiquitin associated and SH3 domain containing A [ Homo sapiens ] |
| Official Symbol | UBASH3A |
| Synonyms | UBASH3A; ubiquitin associated and SH3 domain containing A; ubiquitin-associated and SH3 domain-containing protein A; CLIP4; STS 2; TULA; T-cell ubiquitin ligand 1; cbl-interacting protein 4; T-cell ubiquitin ligand protein; suppressor of T-cell receptor signaling 2; STS-2; TULA-1; |
| Gene ID | 53347 |
| mRNA Refseq | NM_001001895 |
| Protein Refseq | NP_001001895 |
| MIM | 605736 |
| UniProt ID | P57075 |
| ◆ Recombinant Proteins | ||
| UBASH3A-510H | Recombinant Human UBASH3A protein(Ala354-Asn623), His-tagged | +Inquiry |
| Ubash3a-6776M | Recombinant Mouse Ubash3a Protein, Myc/DDK-tagged | +Inquiry |
| UBASH3A-2813H | Recombinant Human UBASH3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UBASH3A-3521H | Recombinant Human UBASH3A protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBASH3A-597HCL | Recombinant Human UBASH3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBASH3A Products
Required fields are marked with *
My Review for All UBASH3A Products
Required fields are marked with *
