Recombinant Human UBR1 Protein, GST-tagged

Cat.No. : UBR1-08H
Product Overview : Human UBR1 partial ORF ( NP_777576, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome.
Molecular Mass : 36.63 kDa
AA Sequence : ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UBR1 ubiquitin protein ligase E3 component n-recognin 1 [ Homo sapiens (human) ]
Official Symbol UBR1
Synonyms UBR1; ubiquitin protein ligase E3 component n-recognin 1; JBS; E3 ubiquitin-protein ligase UBR1; E3a ligase; N-recognin-1; RING-type E3 ubiquitin transferase UBR1; ubiquitin ligase E3 alpha-I; ubiquitin-protein ligase E3-alpha; ubiquitin-protein ligase E3-alpha-1; ubiquitin-protein ligase E3-alpha-I; EC 2.3.2.27
Gene ID 197131
mRNA Refseq NM_174916
Protein Refseq NP_777576
MIM 605981
UniProt ID Q8IWV7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBR1 Products

Required fields are marked with *

My Review for All UBR1 Products

Required fields are marked with *

0
cart-icon