Recombinant Human UBR1 Protein, GST-tagged
Cat.No. : | UBR1-08H |
Product Overview : | Human UBR1 partial ORF ( NP_777576, 2 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UBR1 ubiquitin protein ligase E3 component n-recognin 1 [ Homo sapiens (human) ] |
Official Symbol | UBR1 |
Synonyms | UBR1; ubiquitin protein ligase E3 component n-recognin 1; JBS; E3 ubiquitin-protein ligase UBR1; E3a ligase; N-recognin-1; RING-type E3 ubiquitin transferase UBR1; ubiquitin ligase E3 alpha-I; ubiquitin-protein ligase E3-alpha; ubiquitin-protein ligase E3-alpha-1; ubiquitin-protein ligase E3-alpha-I; EC 2.3.2.27 |
Gene ID | 197131 |
mRNA Refseq | NM_174916 |
Protein Refseq | NP_777576 |
MIM | 605981 |
UniProt ID | Q8IWV7 |
◆ Recombinant Proteins | ||
Ubr1-443M | Recombinant Mouse Ubr1 protein, His&His-tagged | +Inquiry |
UBR1-08H | Recombinant Human UBR1 Protein, GST-tagged | +Inquiry |
UBR1-17760M | Recombinant Mouse UBR1 Protein | +Inquiry |
UBR1-9859M | Recombinant Mouse UBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBR1 Products
Required fields are marked with *
My Review for All UBR1 Products
Required fields are marked with *
0
Inquiry Basket