Recombinant Mouse Ubr1 protein, His&His-tagged

• Cat.No.: Ubr1-443M
• Product Overview: Recombinant Mouse Ubr1 protein(O70481)(1101-1204aa), fused with N-terminal His tag and C-terminal His tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1101-1204aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 16.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: CILCQEEQEVKLENNAMVLSACVQKSTALTQHRGKPVDHLGETLDPLFMDPDLAHGTYTGSCGHVMHAVCWQKYFEAVQLSSQQRIHVDLFDLESGEYLCPLCK

Gene Information

• Gene Name: Ubr1 ubiquitin protein ligase E3 component n-recognin 1 [ Mus musculus ]
• Official Symbol: Ubr1
• Synonyms: UBR1; ubiquitin protein ligase E3 component n-recognin 1; E3 ubiquitin-protein ligase UBR1; E3 alpha; N-recognin-1; ubiquitin-protein ligase E3-alpha-1; ubiquitin-protein ligase E3-alpha-I; ubiquitin-protein ligase e3 componen n-recognin; AI504731
• Gene ID: 22222
• mRNA Refseq: NM_009461
• Protein Refseq: NP_033487