Recombinant Human UCMA Protein, GST-tagged

Cat.No. : UCMA-434H
Product Overview : Human C10orf49 full-length ORF (AAH18068.2, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 41.58 kDa
AA Sequence : MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ]
Official Symbol UCMA
Synonyms UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49;
Gene ID 221044
mRNA Refseq NM_145314
Protein Refseq NP_660357
UniProt ID Q8WVF2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCMA Products

Required fields are marked with *

My Review for All UCMA Products

Required fields are marked with *

0
cart-icon