Recombinant Human UCMA Protein, GST-tagged
Cat.No. : | UCMA-434H |
Product Overview : | Human C10orf49 full-length ORF (AAH18068.2, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 41.58 kDa |
AA Sequence : | MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ] |
Official Symbol | UCMA |
Synonyms | UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49; |
Gene ID | 221044 |
mRNA Refseq | NM_145314 |
Protein Refseq | NP_660357 |
UniProt ID | Q8WVF2 |
◆ Recombinant Proteins | ||
UCMA-17785M | Recombinant Mouse UCMA Protein | +Inquiry |
Ucma-531R | Recombinant Rat Ucma Protein, His-tagged | +Inquiry |
UCMA-9870M | Recombinant Mouse UCMA Protein, His (Fc)-Avi-tagged | +Inquiry |
UCMA-1700HF | Recombinant Full Length Human UCMA Protein, GST-tagged | +Inquiry |
UCMA-2511H | Recombinant Human UCMA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCMA-529HCL | Recombinant Human UCMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCMA Products
Required fields are marked with *
My Review for All UCMA Products
Required fields are marked with *
0
Inquiry Basket