Recombinant Human UCMA protein, GST-tagged
Cat.No. : | UCMA-301149H |
Product Overview : | Recombinant Human UCMA (27-139 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Val27-Thr139 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | VSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ] |
Official Symbol | UCMA |
Synonyms | UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49; |
Gene ID | 221044 |
mRNA Refseq | NM_145314 |
Protein Refseq | NP_660357 |
UniProt ID | Q8WVF2 |
◆ Recombinant Proteins | ||
UCMA-2511H | Recombinant Human UCMA protein, His-tagged | +Inquiry |
UCMA-17785M | Recombinant Mouse UCMA Protein | +Inquiry |
Ucma-531R | Recombinant Rat Ucma Protein, His-tagged | +Inquiry |
UCMA-22H | Recombinant Human UCMA protein | +Inquiry |
UCMA-434H | Recombinant Human UCMA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCMA-529HCL | Recombinant Human UCMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCMA Products
Required fields are marked with *
My Review for All UCMA Products
Required fields are marked with *