Recombinant Human UNC5C protein, His-tagged

• Cat.No.: UNC5C-4718H
• Product Overview: Recombinant Human UNC5C protein(O95185-2)(61-270 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 61-270 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 25.8 kDa
• AASequence: LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: UNC5C unc-5 homolog C (C. elegans) [ Homo sapiens ]
• Official Symbol: UNC5C
• Synonyms: UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3
• Gene ID: 8633
• mRNA Refseq: NM_003728
• Protein Refseq: NP_003719
• MIM: 603610
• UniProt ID: O95185