Recombinant Human UNC5C protein, His-tagged
| Cat.No. : | UNC5C-4718H |
| Product Overview : | Recombinant Human UNC5C protein(O95185-2)(61-270 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 61-270 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 25.8 kDa |
| AASequence : | LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | UNC5C unc-5 homolog C (C. elegans) [ Homo sapiens ] |
| Official Symbol | UNC5C |
| Synonyms | UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3; |
| Gene ID | 8633 |
| mRNA Refseq | NM_003728 |
| Protein Refseq | NP_003719 |
| MIM | 603610 |
| UniProt ID | O95185 |
| ◆ Recombinant Proteins | ||
| UNC5C-4718H | Recombinant Human UNC5C protein, His-tagged | +Inquiry |
| UNC5C-1072H | Active Recombinant Human UNC5C Protein, Fc Chimera | +Inquiry |
| UNC5C-164H | Recombinant Human UNC5C Protein, His (Fc)-Avi-tagged | +Inquiry |
| UNC5C-633H | Recombinant Human UNC5C Protein, MYC/DDK-tagged | +Inquiry |
| UNC5C-6452R | Recombinant Rat UNC5C Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC5C Products
Required fields are marked with *
My Review for All UNC5C Products
Required fields are marked with *
