Recombinant Human UNC5C protein, His-tagged

Cat.No. : UNC5C-4718H
Product Overview : Recombinant Human UNC5C protein(O95185-2)(61-270 aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 61-270 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 25.8 kDa
AASequence : LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name UNC5C unc-5 homolog C (C. elegans) [ Homo sapiens ]
Official Symbol UNC5C
Synonyms UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3;
Gene ID 8633
mRNA Refseq NM_003728
Protein Refseq NP_003719
MIM 603610
UniProt ID O95185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UNC5C Products

Required fields are marked with *

My Review for All UNC5C Products

Required fields are marked with *

0
cart-icon
0
compare icon