Recombinant Human UNC5C protein, His-tagged
Cat.No. : | UNC5C-4718H |
Product Overview : | Recombinant Human UNC5C protein(O95185-2)(61-270 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 61-270 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 25.8 kDa |
AASequence : | LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | UNC5C unc-5 homolog C (C. elegans) [ Homo sapiens ] |
Official Symbol | UNC5C |
Synonyms | UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3; |
Gene ID | 8633 |
mRNA Refseq | NM_003728 |
Protein Refseq | NP_003719 |
MIM | 603610 |
UniProt ID | O95185 |
◆ Recombinant Proteins | ||
UNC5C-6452R | Recombinant Rat UNC5C Protein | +Inquiry |
UNC5C-17849M | Recombinant Mouse UNC5C Protein | +Inquiry |
UNC5C-1072H | Active Recombinant Human UNC5C Protein, Fc Chimera | +Inquiry |
UNC5C-674H | Recombinant Human UNC5C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UNC5C-5796Z | Recombinant Zebrafish UNC5C | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC5C Products
Required fields are marked with *
My Review for All UNC5C Products
Required fields are marked with *
0
Inquiry Basket