Recombinant Human UQCRH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UQCRH-6506H
• Product Overview: UQCRH MS Standard C13 and N15-labeled recombinant protein (NP_005995) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
• Molecular Mass: 10.7 kDa
• AA Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UQCRH ubiquinol-cytochrome c reductase hinge protein [ Homo sapiens (human) ]
• Official Symbol: UQCRH
• Synonyms: UQCRH; ubiquinol-cytochrome c reductase hinge protein; cytochrome b-c1 complex subunit 6, mitochondrial; QCR6; ubiquinol cytochrome c reductase; complex III subunit VIII; UQCR8; complex III subunit 6; mitochondrial hinge protein; cytochrome c1 non-heme 11 kDa protein; ubiquinol-cytochrome c reductase complex 11 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VIII; MGC111572
• Gene ID: 7388
• mRNA Refseq: NM_006004
• Protein Refseq: NP_005995
• MIM: 613844
• UniProt ID: P07919