Recombinant Human USP45 protein, His-tagged
| Cat.No. : | USP45-362H |
| Product Overview : | Recombinant Human USP45 protein(1-289 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-289 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MRVKDPTKALPEKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLEERRFYDGQLVLTSDIWLCLKCGFQGCGKNSESQHSLKHFKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLGNTCFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDPLVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKRVHLHLI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | USP45 ubiquitin specific peptidase 45 [ Homo sapiens ] |
| Official Symbol | USP45 |
| Synonyms | USP45; ubiquitin specific peptidase 45; ubiquitin specific protease 45; ubiquitin carboxyl-terminal hydrolase 45; MGC14793; ubiquitin thioesterase 45; deubiquitinating enzyme 45; ubiquitin thiolesterase 45; ubiquitin-specific-processing protease 45; |
| Gene ID | 85015 |
| mRNA Refseq | NM_001080481 |
| Protein Refseq | NP_001073950 |
| UniProt ID | Q70EL2 |
| ◆ Recombinant Proteins | ||
| USP45-17932M | Recombinant Mouse USP45 Protein | +Inquiry |
| USP45-3631H | Recombinant Human USP45, GST-tagged | +Inquiry |
| USP45-362H | Recombinant Human USP45 protein, His-tagged | +Inquiry |
| USP45-9969M | Recombinant Mouse USP45 Protein, His (Fc)-Avi-tagged | +Inquiry |
| USP45-190H | Active Recombinant Human USP45, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP45-453HCL | Recombinant Human USP45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP45 Products
Required fields are marked with *
My Review for All USP45 Products
Required fields are marked with *




