Recombinant Human USP6 protein(348-535aa), His-KSI-tagged

Cat.No. : USP6-7121H
Product Overview : Recombinant Human USP6 protein(P35125)(348-535aa), fused with N-terminal His and KSI tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&KSI
Protein Length : 348-535aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.0 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : KLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLS
Gene Name USP6 ubiquitin specific peptidase 6 (Tre-2 oncogene) [ Homo sapiens ]
Official Symbol USP6
Synonyms USP6; ubiquitin specific peptidase 6 (Tre-2 oncogene); HRP1, ubiquitin specific protease 6 (Tre 2 oncogene); ubiquitin carboxyl-terminal hydrolase 6; TBC1D3 and USP32 fusion; Tre 2; Tre2; TRE17; ubiquitin carboxyl terminal hydrolase 6; tre-2 oncogene; proto-oncogene TRE-2; hyperpolymorphic gene 1; ubiquitin thioesterase 6; deubiquitinating enzyme 6; ubiquitin thiolesterase 6; ubiquitin specific peptidase 6-; ubiquitin-specific protease USP6; ubiquitin-specific-processing protease 6; ubiquitin specific protease 6 (Tre-2 oncogene); HRP1; TRE2; Tre-2; USP6-short;
Gene ID 9098
mRNA Refseq NM_004505
Protein Refseq NP_004496
MIM 604334
UniProt ID P35125

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All USP6 Products

Required fields are marked with *

My Review for All USP6 Products

Required fields are marked with *

0
cart-icon