Recombinant Human USP6 protein(348-535aa), His-KSI-tagged
Cat.No. : | USP6-7121H |
Product Overview : | Recombinant Human USP6 protein(P35125)(348-535aa), fused with N-terminal His and KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 348-535aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLS |
Gene Name | USP6 ubiquitin specific peptidase 6 (Tre-2 oncogene) [ Homo sapiens ] |
Official Symbol | USP6 |
Synonyms | USP6; ubiquitin specific peptidase 6 (Tre-2 oncogene); HRP1, ubiquitin specific protease 6 (Tre 2 oncogene); ubiquitin carboxyl-terminal hydrolase 6; TBC1D3 and USP32 fusion; Tre 2; Tre2; TRE17; ubiquitin carboxyl terminal hydrolase 6; tre-2 oncogene; proto-oncogene TRE-2; hyperpolymorphic gene 1; ubiquitin thioesterase 6; deubiquitinating enzyme 6; ubiquitin thiolesterase 6; ubiquitin specific peptidase 6-; ubiquitin-specific protease USP6; ubiquitin-specific-processing protease 6; ubiquitin specific protease 6 (Tre-2 oncogene); HRP1; TRE2; Tre-2; USP6-short; |
Gene ID | 9098 |
mRNA Refseq | NM_004505 |
Protein Refseq | NP_004496 |
MIM | 604334 |
UniProt ID | P35125 |
◆ Recombinant Proteins | ||
USP6-0355H | Recombinant Human USP6 Protein (K529-Q1406), GST tagged | +Inquiry |
USP6-7121H | Recombinant Human USP6 protein(348-535aa), His-KSI-tagged | +Inquiry |
USP6-0356H | Recombinant Human USP6 Protein (K529-Q1406), Tag Free | +Inquiry |
USP6-154H | Active Recombinant Human USP6, GST-tagged | +Inquiry |
USP6-277H | Recombinant Human USP6, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP6 Products
Required fields are marked with *
My Review for All USP6 Products
Required fields are marked with *