Recombinant Human USP6 protein(348-535aa), His-KSI-tagged

• Cat.No.: USP6-7121H
• Product Overview: Recombinant Human USP6 protein(P35125)(348-535aa), fused with N-terminal His and KSI tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&KSI
• Protein Length: 348-535aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLS

Gene Information

• Gene Name: USP6 ubiquitin specific peptidase 6 (Tre-2 oncogene) [ Homo sapiens ]
• Official Symbol: USP6
• Synonyms: USP6; ubiquitin specific peptidase 6 (Tre-2 oncogene); HRP1, ubiquitin specific protease 6 (Tre 2 oncogene); ubiquitin carboxyl-terminal hydrolase 6; TBC1D3 and USP32 fusion; Tre 2; Tre2; TRE17; ubiquitin carboxyl terminal hydrolase 6; tre-2 oncogene; proto-oncogene TRE-2; hyperpolymorphic gene 1; ubiquitin thioesterase 6; deubiquitinating enzyme 6; ubiquitin thiolesterase 6; ubiquitin specific peptidase 6-; ubiquitin-specific protease USP6; ubiquitin-specific-processing protease 6; ubiquitin specific protease 6 (Tre-2 oncogene); HRP1; TRE2; Tre-2; USP6-short
• Gene ID: 9098
• mRNA Refseq: NM_004505
• Protein Refseq: NP_004496
• MIM: 604334
• UniProt ID: P35125