Recombinant Human UTS2 protein, His-tagged

• Cat.No.: UTS2-51H
• Product Overview: Recombinant Human UTS2 fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Molecular Mass: 36.88 kD
• AA Sequence: MKKGHHHHHHLVPRGSKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGA ERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
• Purity: Greater than 95% by SDS-PAGE gel analyses.
• Applications: Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
• Storage: - 20°C for Lyophilized, - 80°C for Liquid

Gene Information

• Gene Name: UTS2 urotensin 2 [ Homo sapiens ]
• Official Symbol: UTS2
• Synonyms: UTS2; urotensin 2; urotensin-2; PRO1068; U II; UCN2; UII; urotensin II; U-II
• Gene ID: 10911
• mRNA Refseq: NM_006786
• Protein Refseq: NP_006777
• MIM: 604097
• UniProt ID: O95399
• Chromosome Location: 1p36
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem
• Function: hormone activity; receptor binding