Recombinant Human UTS2 protein, His-tagged UTS2-51H

Recombinant Human UTS2 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human UTS2 protein, His-tagged

Recombinant Human UTS2 protein, His-tagged

UTS2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : UTS2-51H
Product Overview : Recombinant Human UTS2 fused with His tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : His
Molecular Mass : 36.88 kD
AA Sequence : MKKGHHHHHHLVPRGSKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGA ERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Purity : Greater than 95% by SDS-PAGE gel analyses.
Applications : Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage : - 20°C for Lyophilized, - 80°C for Liquid
Gene Name : UTS2 urotensin 2 [ Homo sapiens ]
Official Symbol : UTS2
Synonyms : UTS2; urotensin 2; urotensin-2; PRO1068; U II; UCN2; UII; urotensin II; U-II;
Gene ID : 10911
mRNA Refseq : NM_006786
Protein Refseq : NP_006777
MIM : 604097
UniProt ID : O95399
Chromosome Location : 1p36
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem;
Function : hormone activity; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy