Recombinant Human UTS2 protein, His-tagged
Cat.No. : | UTS2-51H |
Product Overview : | Recombinant Human UTS2 fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Molecular Mass : | 36.88 kD |
AA Sequence : | MKKGHHHHHHLVPRGSKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGA ERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV |
Purity : | Greater than 95% by SDS-PAGE gel analyses. |
Applications : | Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies. |
Storage : | - 20°C for Lyophilized, - 80°C for Liquid |
Gene Name | UTS2 urotensin 2 [ Homo sapiens ] |
Official Symbol | UTS2 |
Synonyms | UTS2; urotensin 2; urotensin-2; PRO1068; U II; UCN2; UII; urotensin II; U-II; |
Gene ID | 10911 |
mRNA Refseq | NM_006786 |
Protein Refseq | NP_006777 |
MIM | 604097 |
UniProt ID | O95399 |
Chromosome Location | 1p36 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem; |
Function | hormone activity; receptor binding; |
◆ Recombinant Proteins | ||
UTS2-6483R | Recombinant Rat UTS2 Protein | +Inquiry |
UTS2-7113C | Recombinant Chicken UTS2 | +Inquiry |
UTS2-5572H | Recombinant Human UTS2 Protein (Pro36-Val124), N-His tagged | +Inquiry |
UTS2-5137R | Recombinant Rhesus monkey UTS2 Protein, His-tagged | +Inquiry |
UTS2-4950R | Recombinant Rhesus Macaque UTS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UTS2 Products
Required fields are marked with *
My Review for All UTS2 Products
Required fields are marked with *