Recombinant Human VCL protein(311-430 aa), C-His-tagged
| Cat.No. : | VCL-2679H |
| Product Overview : | Recombinant Human VCL protein(P18206)(311-430 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 311-430 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | ELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDD |
| Gene Name | VCL vinculin [ Homo sapiens ] |
| Official Symbol | VCL |
| Synonyms | VCL; vinculin; metavinculin; MVCL; CMD1W; CMH15; |
| Gene ID | 7414 |
| mRNA Refseq | NM_003373 |
| Protein Refseq | NP_003364 |
| MIM | 193065 |
| UniProt ID | P18206 |
| ◆ Recombinant Proteins | ||
| VCL-6507R | Recombinant Rat VCL Protein | +Inquiry |
| VCL-68H | Recombinant Human VCL, His tagged | +Inquiry |
| VCL-6549H | Recombinant Human VCL Protein (Lys1020-Gln1134), N-His tagged | +Inquiry |
| VCL-7919H | Recombinant Human VCL | +Inquiry |
| Vcl-1869M | Recombinant Mouse Vcl protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| VCL-899T | Native Turkey VCL Protein | +Inquiry |
| VCL-6507RB | Recombinant Full Length Rat VCL Protein, His-tagged, Biotin Labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VCL-900MCL | Recombinant Mouse VCL cell lysate | +Inquiry |
| VCL-1687HCL | Recombinant Human VCL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VCL Products
Required fields are marked with *
My Review for All VCL Products
Required fields are marked with *
